KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_06196Help
Entry
DFA_06196         CDS       T02668                                 

Gene name
pikC
Definition
phosphatidylinositol-4,5-diphosphate 3-kinase
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DFA_06196 (pikC)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    DFA_06196 (pikC)
Enzymes [BR:dfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     DFA_06196 (pikC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1536 aa AA seqDB search
MSSTTLDVIDIDDEDSNKSLLTINLVVDKGSTSTTSSSSSSPDNNTETTETVDNKEYLTV
FIQKDKCLHSDVPCFISSLKTQLLNTLKELEDFESNHKEYSTNSNYSSWLNYLQSFQTDK
IVQSNVYLTIPNNNNNKIDKHVGVVENTVVVAGSITTTTTESTTTTESLATPSTNNVEEE
EEEEEEEEEEEEEEEKEKEQQQESASSSTLNDGEDTKPNEEKKKMSLKITDIKLNTTPTD
GDNNNNNNASTISNSLPPLMLSSSSSSSSNPGSPSLSSTSKRWTSTKPTGSMFFAGGSSL
GTIPGGLPGTTTTTSTGVGGGVPMSLREGSSLSLRSQMAMSSGGGAAGSSIGASLGTSGS
RFFTPRESVNLSGGGSGAQSSSPLLISKTSSSSEDQDQDQQQKEQQQEQSDNQTNQNNSS
PTSAAAMQTYDNCPSVHDDYEEEKEIPALAESFETNVIVLLPCRHHIKVPASSISTIESI
RQLAWATAKMQGHRIKNNLKAYFFKWNNSEILFDKESTIKDLVVYPPSSMFVNGTQTSIR
FELIEKDTMCKERLVDLQASEINGRPSYWKAHIDEVITFNRKNRMLASLARDTPGSIENA
RLTPYPPPSTIPEFFVIKIHLRNQTKSLRCTRNHTAETLMAILSEKVKNTLPFDPSQWRF
LITGKYQYIRPKVPLLSVELVVESIKRTGEVTLTMVELNELGLREDIRMSNIFDQNPKYA
HRQSPILDIIFSHKKQKHNRQALGGSTNTSNTSSPIGSISDSLPSTPPASTSTTSLPDIY
NLSLSPQQQQQQQSLSTSALPDLQNAIQQQDDITLPTTTINALEIHENFQLRLLHAHEID
SASVKGHFSTNDMSNIMIYVEFGIYYGGLLIAPTVTSKPIPFQDTIVWNEWITLPIALSS
IPLGSRLCFSINAKHRDNNVALGWVGHRIYDSENLFYTSTPYSLLLWPGKVNPIGTCVDN
LQSKDQAIIIAFEFHDYSTPHNIHYPDLLLCTAQEPIPSIDIGDHEKVNLILRQDPLYSL
SEDEKQLMWKSRYYCQTLPHSLSKLLQSVQWTNISRVGEMFRLLNNWPLLSPITSLELLD
PKFADCIKIREYVVKCLDHITDYELELYMLQLVQAIKHDCFHGSALSLFLLGRVFQNTSV
LAHPFFWNLRADLDNQEVSERFRLLTAAFLRFTPHLHEPFKQQIQTLGILEGIAKQVKEV
SLDKRKPLIEELLRAEKNLPSSLTVPFDPTIKVMDIIPEKCKSMDSAKVPLWVVYKNRDL
HATNFQMIVKTGDDLRQDILTLQLLKLMDHMWKSEGLDLHMTIYRCIATGMGTGLIEVVG
NAETAAKIQAAAGGMTGAFKQTPIANWLKNGNLTENNYQKAVTKFTLSCAGYCVATYVLG
IGDRHNDNIMVDKFGHLFHIDFGHFLGNFKTWAGFQREKAPFVLTPDFVYVIGNKDSPNF
QFFVETCCKAYNILRKNDHIFYSMFELMLSTGIPELKCEQDIMYLRDKFRSDLSDEEASE
RFTKLIHESIHTLTTQVNFAIHIFARSHSLKEKSSN
NT seq 4611 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgaccacattagatgttattgatatcgatgatgaagattcaaacaagtcatta
cttactatcaatctagttgttgataaaggttcgacgtcaacaacatcatcatcatcatca
tctcccgacaacaatacagaaacaacagaaacagtagacaacaaagaatatttaacagta
tttattcaaaaagataaatgtcttcattcagatgtaccttgttttatttcatcactaaag
acacaactattaaatacactcaaagagttggaagactttgaatcaaaccacaaagagtat
agcacaaattcaaattattcatcttggttaaactatttgcaatcctttcaaactgataaa
atagtacaatcaaatgtttatctaactattccaaataataataataacaaaatagataaa
catgttggtgttgttgagaatacagtagttgttgctggctcgataacaacaaccaccact
gaatcaaccacaactactgaatctttggccactccctcaacaaataatgtagaagaagaa
gaagaagaagaagaagaagaagaagaagaagaagaagaagaagaaaaagaaaaagaacaa
caacaagagtctgcttcatcttcaacattgaatgatggtgaagacaccaaaccaaatgaa
gaaaagaaaaagatgagtttaaagattacagatattaaattaaatactacaccaacagat
ggtgataataataataataataatgctagcacgatatcaaattctctaccacctttgatg
ttatcatcatcatcatcatcatcgtctaatcctggatcaccttcattgtcatctacatcc
aagagatggacatcaacaaaaccaactgggtcaatgttttttgcaggtggttctagtctt
ggaacaattcctggtggattaccaggtacaacaacaacaacatcaactggtgttggtggt
ggagtaccaatgtcgctaagagaaggttcttcattatcacttcgtagtcaaatggctatg
agtagtggaggaggagcagctggatcaagtattggtgccagtcttggtacaagtggtagt
agattctttactccaagagaaagtgttaatctaagtggtggtggtagtggtgcacaatca
tcatctccattactcatttctaaaacatcatcatcatcagaggatcaagatcaagatcaa
caacaaaaagaacaacaacaagaacaatcggataatcaaacgaatcaaaataattcatca
cctacgagtgcagcagcaatgcaaacctatgacaactgtccatcggttcatgacgactat
gaagaggaaaaggagattccagcattggctgaatcatttgaaaccaatgtgattgttttg
ttgccgtgtagacatcacatcaaggtaccagcatcgagtatttcgacgattgaatcgatc
agacagctggcatgggcaaccgccaagatgcaaggacacaggataaagaataatctgaaa
gcttatttcttcaagtggaacaactcggagattttgtttgacaaggagtcgactatcaag
gatttggttgtgtatcctccatcgtccatgtttgtcaatggaacacagacgagcatacga
ttcgagttgattgaaaaggataccatgtgcaaggagcgacttgtggatctacaggcatcg
gaaatcaacgggcgtccgtcctattggaaagcacatattgacgaagtcatcacattcaac
cgaaagaatagaatgttggcatcgttggcacgtgatacacccggctcgatagaaaatgcc
cgtcttacaccatacccacctccctctaccatcccagagtttttcgtcatcaagatccat
ctccgcaaccaaaccaagtctcttcgttgcacacgaaatcatactgcagagacactcatg
gcaatcctctctgaaaaagtcaaaaacacattgccttttgatccttcgcaatggcgattc
ctcattactggaaagtaccaatacattcgtccaaaggtacctctcttgtcggtcgagtta
gtagtagagagtataaagagaacgggtgaggtcactctaacgatggtcgagttgaacgag
cttgggttacgtgaagacattagaatgagtaatatatttgaccagaatccaaaatatgca
cacagacaatcacccatactcgacattattttcagtcacaagaaacaaaaacataatcga
caggcgttgggaggtagtaccaatactagcaacacttcttctccgattggatcgatttcc
gactcgttaccttcaactcctccagcatctacatccaccacttcactacccgatatttac
aatctatcgctgtcaccacaacaacaacaacaacaacaatcattatcaacatcggcacta
ccagatttacaaaatgcaattcaacaacaagacgatattacactcccaactacaaccatc
aatgcattagagattcatgaaaacttccaactccgactacttcacgcacacgaaattgat
tcggccagtgtaaagggtcactttagtaccaatgatatgtcaaatatcatgatctatgtg
gaatttggtatttattatggaggtttattgattgcaccaaccgttacaagcaaacctata
ccattccaagacactatagtatggaatgaatggattacactacctattgcactatcttcg
attccacttggatcgagattatgtttctctatcaatgccaagcatcgtgacaataatgtt
gcacttggatgggtgggtcatcgtatctatgactcggagaatcttttttatactagtaca
ccctacagtcttttgctttggccaggcaaggtcaacccaatcggcacctgtgtagataat
ttacaatcaaaggatcaggccatcatcattgcctttgaattccacgactattccactcca
cacaacattcattaccccgacctactgttgtgcacagctcaagaaccaatcccatccatc
gatataggtgatcatgaaaaggtcaacctcatactacgtcaagatccactctactcactc
tctgaagacgagaaacaattaatgtggaaatctagatactattgtcaaacacttcctcat
tcactctctaaattacttcaatctgtacaatggacaaatatcagtcgtgttggtgaaatg
tttagattattaaataattggcctttattatccccaattacttctttagaattattagat
ccaaagtttgcagattgtataaaaattagagaatatgtagtaaaatgtttagatcatata
acagattatgaattggaattatatatgttacaattggtacaagctattaaacacgattgt
ttccatggaagtgcactttcattgtttttgcttggtcgggttttccaaaacacttctgta
ttggcacacccattcttttggaatttaagagccgacttggacaatcaagaggttagtgaa
agattcaggttgttgacggcggcatttttacgatttactccacatttgcacgaaccattt
aaacaacaaatacaaacacttggcattctcgagggtattgcaaagcaggttaaagaagtg
tctctagataagagaaaacctttaatcgaagaattgcttcgagctgaaaagaatctacca
tcatcgctcactgtaccatttgacccgaccatcaaggtaatggacattatccccgaaaaa
tgcaaaagtatggatagcgccaaagtacctctatgggtagtatacaaaaacagagacctc
cacgccaccaactttcaaatgattgtgaaaactggtgatgatcttagacaagatattcta
acgttgcaactactcaaacttatggatcacatgtggaagagtgaaggattggatttacat
atgaccatctatcgttgtattgccactggtatgggtacaggactcatcgaagtcgttgga
aatgctgaaacagccgccaagattcaagcagctgccggtggcatgactggtgcattcaag
caaacacccattgccaattggttaaagaatggtaatctcactgaaaacaattatcaaaag
gctgttacaaaattcactctatcatgtgccggttattgtgttgccacctatgtcttggga
atcggtgatcgacacaacgacaatattatggtagataaatttggtcatctatttcatatt
gactttggacatttccttggtaattttaaaacatgggcaggattccaaagagaaaaggct
ccttttgtattaacaccagattttgtatatgtaattggtaacaaggattcaccaaacttt
caattctttgttgaaacttgttgcaaggcctataatattctcagaaagaatgaccatata
ttttacagcatgtttgagctgatgttaagtactggtatcccagaacttaaatgtgagcaa
gacattatgtatcttcgtgacaagtttagaagtgatctcagtgacgaagaagcatccgaa
cgtttcacaaaactaatccatgaatcaattcatactctaaccactcaagttaactttgca
attcatatttttgcaagaagtcattctctaaaagaaaaatcatcaaattaa

DBGET integrated database retrieval system