KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_06486Help
Entry
DFA_06486         CDS       T02668                                 

Definition
HAM group protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Brite
Enzymes [BR:dfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DFA_06486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 423 aa AA seqDB search
MLDKSPAEEEPTSPIDPQANRKILDPGSNIHCKWRDQYHKCEIIERKESESLPGTYDYYV
HYHEFNRRLDEWVHESRFDFSKIENEPKAPPPPLAEIQNADGQRLKVTRHYKRKFDEINH
IQKGEDDTKLSALEKEHEEITKVKNINVIELGRYEIDTWYFSPYPEEFAKCEKLYLCEFC
LKYMKKKKTLNRHKLKCDLRHPPGNEIYRSQSLSMFEVDGKKNKIYCQNLCLLAKLFLDH
KTLYYDVEPFLFYVMTECDSRGCHMVGYFSKEKDSPDGYNLACILTLPPYQRKGYGKLLI
SFSYELSKKENKVGTPEKPLSDLGLLSYRSYWTQVLLEILRKHKLVNLSIMDISSMTSIR
TEDIISTLQSLNLIRYWKGQHIISVTPKAIEEHLKAYSKQTTRIEPKCIHWAPMNPPLSA
KKR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttggataaatcacctgctgaagaagaaccaacctctcccatagatccacaagcaaat
agaaaaatattggatcctggttcaaatattcattgtaaatggagagatcaatatcataaa
tgtgaaattattgaaagaaaagaatcagaatcacttccaggtacatatgattattatgtt
cattatcatgaatttaatcgtcgtttggatgaatgggttcatgaatcaagatttgatttt
agtaaaatagaaaatgaaccaaaggctcctccacctcctttggctgaaattcaaaatgct
gatggtcaaagattaaaagtaacaagacattataaaagaaaatttgatgagattaatcat
attcaaaaaggagaagatgatacaaaattatcggcattggaaaaggaacatgaagaaata
acaaaggtcaagaatataaatgtgattgaattgggacgatatgaaatagatacttggtac
ttttcaccatacccagaagaatttgccaaatgtgaaaaattgtatctatgtgaattttgt
ctcaaatatatgaagaaaaagaaaacactcaatcgtcataaactcaaatgtgacttgcgt
catccacctggtaatgaaatctatcgtagtcagtcattatcaatgtttgaagttgatggt
aaaaagaataagatctattgtcagaatctttgtcttttggccaaactatttttagatcat
aaaacactctactatgacgttgaaccattcctcttttatgtaatgaccgaatgtgattca
cgtggttgtcatatggttggatacttttccaaagaaaaggattcacccgatggttacaat
ttagcttgtatcctaacattaccaccctatcaaagaaaaggttatggtaaattattaatt
tcattttcatatgaattatcaaaaaaagaaaataaagtaggaacaccagagaaaccatta
tcagatttgggattgttatcatatcgttcgtattggacacaagtattattggagatttta
agaaaacataaattggttaatctttcgattatggatatatccagtatgacatcgatacga
acagaagatattatcagtacattacaatcactcaatcttattcgttactggaaaggtcaa
catattatatcggttacacccaaagcaatcgaagaacatctcaaagcatactctaaacaa
actactcgaattgaaccaaaatgtattcattgggctccaatgaatccacctttatcagca
aaaaaaagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system