KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_06619Help
Entry
DFA_06619         CDS       T02668                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    DFA_06619
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    DFA_06619
Enzymes [BR:dfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     DFA_06619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1200 aa AA seqDB search
MEEKDEGDDLFFFDNTNDNKILNATSPSNMMRPQQHRQQQQQQQKQQHQHNTNLLIATTN
ENNNTTNTSSNNDLIDFEQATIDEYEEINFFSSPISSSIGYNSSSTLLDNSIAAQTLEKF
FVTNNNKNQDNILQVNHHVTDDAINDSIRLNFGFVDGEDRAATITENTTTTNSTSTTSTL
TTTTTSSTTTTTIEDINQSNIDFNGQIEQGSSSCLEEQIPTFDPSTNNLNLNNLNLNNNN
NNNNLNNSSTYSVVSTENIKSMAINSLAFTKSTIMSAYNAKPVQNLLSFSTDNFWNDLGE
EVEERSKSENSTFEEEDIQSEMEKWQRLGEDIPPHCWTRALNNQFPDHKKFQVSFGQGIK
LMGLGYRMWKYVKREMNAGRLPIMDPFNMPNPGPIMGVPIGGIGCGSITRGWRGDFVRWN
LSNGVVTNKVVDANNFSVFIKMNNQGSTSSSSSSSSSSATNKLATVLCQGKPRNNQNLDV
WNWALKGDKSSYFGMFPRAWTVYEEPHPDIKLVCKQVSPVIAHNYQESSYPCAVFVWKID
NSAPVSADISLMFTWQNGDGTDSTDQLGGHYNRSFSLDNGKFRGITLNTNRSASQNSSME
LSIGALCDEPGSNFSYVSRFETTNRLEAANLWYSFNKNGVLDNSDDTRPNQAKKPIGAAI
AYKVRVEAQSSRQIVFAVAWDSPYCTFNSGKSIYPRRYTKFFGTSGNNSQSIAHYASLNY
QNWEQQINSWQNPILQDPQLPSFYKKALFNELYFLVDGGSIWTINQNNQNNNQNNIIDNN
NNNNNNYIYDKEIGQFAYLESQEYLMYNTYDVHFYASFALATLWPSLEFSLQSGIADATM
EDYGGETVECIHSGKQIPRKLRGTVPHDIGNPGEDPWKRVNAYNIQDISRWKDLPCKFIL
QVYRDYLLTSVDSSGQKSNATSSSFGQEYIPLDGDRGFLLQMWGTVEEVIRKAFEFDTDD
DGVIDNEGFPDQTYDTWSASGCSAYTGGLWLAAIKATSAMARILGLRDDEEVYSKLFEKG
KKSYNKKLWNGHYFNYDSSKQSHYNSIMADQLAGHWYLTSCGLSSYMTLDQALSTLSIIN
EYNIKSYSNGSCGAVNGISPLAIVDQTCLQSSEVWIGTSYSLASTFLLHYMDKEAWSLIK
GLVNSSYEKWGFQYQTPEAWDMNGSFRASTYMRPLAIWSVQWALSRRSKALLFINDPKKQ
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaagacgaaggagatgatctcttcttttttgataataccaacgacaataag
atattgaatgcaacttcaccatcaaatatgatgagacctcaacaacatcgtcaacaacaa
caacaacaacaaaaacagcaacatcaacacaatacaaacttgctaatagcaactaccaat
gaaaataacaatacaaccaacactagcagcaacaatgatttaattgattttgaacaagct
acaatcgacgaatatgaagaaattaacttcttttcttctcccatatcgtcttctattgga
tacaatagttcttcaactcttcttgacaacagcattgctgctcagactttagagaaattc
tttgttaccaacaacaacaaaaatcaagataacatattgcaagtgaatcatcatgtcact
gacgatgctatcaatgattctatcaggctaaattttgggtttgttgatggtgaggatcga
gcagctacaattacagaaaatactacgacaacaaattcaacatcaacaacatcaacatta
acaacaacaacaacatcatcaacaacaacaacaacaatagaggatataaaccaatccaat
atcgattttaatggacaaattgaacaaggatcatcatcttgtttggaggaacaaatccct
acattcgatccttctacaaataatcttaatcttaataatcttaatcttaacaataataat
aataataataatcttaataatagttcaacctattcagtagtttctactgaaaacataaaa
tcgatggcaatcaattcacttgcatttacaaagagcacaatcatgtcagcatataacgcc
aaacctgttcaaaatcttttaagctttagcacagataacttttggaatgatcttggagaa
gaggttgaggaaaggagtaaatctgaaaactctacctttgaagaggaagacattcaatcg
gaaatggaaaagtggcagagattgggtgaggatattcctccccattgttggacaagggcc
ctcaacaatcagtttcctgatcacaaaaaatttcaagtatcatttggtcaaggaattaaa
ttaatgggtctagggtatagaatgtggaaatatgtaaagagagaaatgaatgcaggtaga
ttaccgattatggatccatttaatatgccaaatccaggaccgattatgggcgtaccaatt
ggtggtattgggtgtggatcgattacacgtggatggagaggtgattttgtaagatggaat
ttatcaaatggagttgtcaccaacaaagtagtcgatgccaataatttttcggtatttatc
aaaatgaacaatcaaggatccacttcttcttcctcttcctcttcttcttcttctgcaacc
aacaaacttgcaactgttttatgtcagggtaaaccaagaaataatcaaaatctagatgtt
tggaactgggcactcaaaggagataaatctagttattttggaatgtttcctcgtgcttgg
accgtctatgaagaacctcatcccgacattaaattggtgtgtaaacaagtgtcaccagtt
atagcgcacaactatcaagagtctagctatccttgtgcagtatttgtgtggaagattgat
aacagtgctccagtatctgcagacattagtttaatgtttacttggcaaaacggtgatggc
actgattccactgatcagctgggaggtcattacaatcgttccttttcgttggacaatgga
aaatttagaggcataacactaaataccaatagaagtgcttcccagaatagtagtatggag
ttgtcaattggtgcactttgtgacgagcctggatcgaatttttcatatgtatcgagattt
gaaacgacaaataggctagaggctgcaaacctatggtacagttttaataagaatggtgtt
ttggataatagtgacgataccagacccaaccaagcgaaaaaaccaattggtgctgccata
gcatacaaagtcagagtagaggctcaatcttcgcgtcaaatagtatttgcggttgcatgg
gattctccttactgtacttttaactctggaaaatctatatatccacgtagatatacaaag
ttttttggaaccagtggcaataatagtcaatcgattgcccattatgcctctctaaactat
caaaattgggaacaacaaatcaattcttggcaaaatcctatcttgcaagatcctcaacta
ccttctttttataaaaaggctctatttaatgaattatactttcttgttgatggtggttca
atttggacaattaatcaaaataatcaaaataataatcaaaataacattatagataataat
aataataataacaataattatatttatgataaagaaattggacaatttgcatatctagaa
agtcaagaatatttaatgtataatacatatgatgtacatttttatgcatcttttgcattg
gctaccctctggccctcgctggaattcagtctacagagtggtatcgccgatgctacgatg
gaagactatggaggagaaactgtagagtgcattcatagtggaaaacaaatccctcgtaaa
ctgaggggaaccgtaccccatgacattggtaatccgggtgaagatccttggaaacgagtc
aacgcatacaatatacaagacatatcaagatggaaagatttaccttgcaagtttattcta
caagtgtaccgtgactaccttttaacatcggtagactctagtggccaaaaaagtaatgct
actagcagcagctttggtcaggaatacattccacttgacggtgatagaggattcttgtta
caaatgtggggaaccgtggaagaggtcatcagaaaggcatttgaatttgatacagacgat
gatggagttattgacaatgaaggtttcccagaccaaacatacgatacatggtctgcaagt
ggatgcagcgcctacacgggtggcctgtggttggcagcaattaaagcaacatcggcaatg
gctcggattcttggtttacgtgacgacgaggaggtgtacagtaaactatttgaaaaagga
aagaaatcatacaacaagaaactgtggaatgggcattactttaattatgactcttcaaaa
caatcgcactacaacagtataatggccgatcaattggctggtcactggtacttaacaagt
tgtggcttgtcttcgtacatgacccttgaccaagctctttctacactatccattatcaat
gaatacaatataaagagttattcaaacggatcttgtggtgccgtaaacgggatttctcct
ttggccattgtcgaccaaacatgtctacaatcaagcgaggtttggataggaacaagctat
tcacttgcaagtacatttcttttacactatatggacaaagaggcttggagtttaattaag
ggactggtaaatagttcctatgaaaaatggggctttcaatatcaaacacctgaggcttgg
gatatgaatggcagtttcagagcctcaacttatatgagacctttggccatttggtcagtc
caatgggcactttcaagacgttcaaaagctcttttatttataaacgatccaaaaaaacaa
taa

DBGET integrated database retrieval system