KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_07346Help
Entry
DFA_07346         CDS       T02668                                 

Gene name
plc
Definition
phosphoinositide-specific phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DFA_07346 (plc)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    DFA_07346 (plc)
Enzymes [BR:dfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     DFA_07346 (plc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 782 aa AA seqDB search
MLSLNDLSIEDHSNNKKDEYLGFRNRTEKKELIVDIQGFDDEDINTYSNHNGVFDQYTDH
GYMIHRVTTKGHLTKKKLVFDLYKSYLICHKKKVGFSEFDEIRIGQKTNVFNHYKSKKTS
VHHSEDCELSFSLMHSNNLKSLDFVCSSVKERIEIVSALYLVIKQSRSSNNELGFIRKQW
DYFGKETLGPNDLRRLLSRLNYSASHGHANELLKAVDKNGDRVLDFIEFSELFKLLRRRP
EIKLLLNKYSKTLEGQLSISEMIDFFKYEQSEEWTEEQCKHLIENSTHDTTIQTMSHEHM
EDYLSSQLNNDVLDPKAKTIYMDTNQPISNYFINSSHNTYLAGHQLQGISSSEMYVLAMK
KNCKCVELDVWDGHDGDPIIFHGHTLTSQIKFKHVIQSIKDYGFENSPYPIVLSLETHCA
PAQQVKMIEHMVAIFGDMLAKPFTEEDVDKVKTLPTLEQLKYKVILKGHYNCRMVSERNQ
VTEVIEEENEEEETDNIHVKEMKPQKMLVAPEYAKWIYFLTKGFKSVEESNTLPPWVMHS
FSEAKVKELVKANGTYSFIDMFTRRQLRVFPKGTRVNSSNYDPVPGWTMGAQIVALNQQT
SSEPMWLNAGMFADNGGCGYVLKSPCLLPSTVSGEFNYFDPSEPTRHASSKYSKLIINII
SARQLPKYTKTEGGEVIDPFVTVSIHGSQLDDREFKTKVIDDNGFNPYWGEEFEFPLIHD
QVAMLLIRVDDKDKFKRQNRIGHYCIKVSNIRNGYRVIKLENGYGNQIPMCNLLCKFTLV
PN
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgctttcactaaatgacttgtcaatagaagaccattcaaataataaaaaggatgaatat
ttaggatttagaaatagaacagaaaagaaagagttgattgttgatatccaaggttttgat
gatgaagatataaatacatattcaaatcataatggagtatttgatcaatatactgatcat
ggttatatgattcatcgtgttactaccaaaggtcatcttaccaaaaagaaattagtattt
gatctttataaaagttatttgatttgtcataaaaagaaagttggattttctgaatttgat
gaaattagaattggacaaaagaccaatgtatttaatcattataaatcaaaaaagacatca
gttcatcattctgaagattgtgaattatcattttcattgatgcacagtaataatttgaaa
tcattggattttgtttgttcatcggtcaaagaaagaatagaaatagtttctgcattgtac
ctcgtaattaaacaatcgagatcatcaaacaatgaacttggatttattcgtaaacaatgg
gattattttggaaaagaaacacttggaccaaatgatctaagaagattattgtcaagacta
aattattctgcttcacatggacatgcaaatgaactgcttaaagcagttgacaagaatggt
gatagagtattggattttatcgagttttcagaactctttaaacttttacgtcgtcgtccc
gagatcaaattacttctcaacaagtattcaaagacattagaaggtcaactttcaattagt
gaaatgattgatttctttaaatacgaacaaagtgaagaatggacagaagaacaatgtaaa
catttaattgaaaactctactcacgacacaaccattcaaacaatgtcccacgaacacatg
gaagattatttatcaagtcaattgaataatgatgttctcgatccaaaagctaaaactata
tacatggatacaaatcaaccaatttcaaattattttataaattcatcacataatacatat
ttagcaggacatcaattacaaggtattagttcaagtgaaatgtatgttttggcaatgaaa
aagaattgtaaatgtgttgaattggacgtttgggatggacatgatggagatccaataata
tttcatggtcatacattgacatcacaaattaaatttaaacatgttattcaaagtataaag
gattatggttttgaaaattcaccataccctattgtactaagtttggagactcattgtgca
ccagctcaacaagtcaagatgattgaacacatggtagctatttttggtgatatgttggcc
aaaccattcaccgaggaagatgttgacaaggtcaagacacttccaactcttgaacaatta
aaatacaaggttattttaaagggacattataattgtagaatggtatctgaaagaaatcag
gtaactgaagtgattgaagaagaaaacgaggaagaagagactgacaatatccatgtcaaa
gagatgaaaccacaaaaaatgttggttgctccagagtatgccaaatggatttactttttg
acaaagggtttcaagtctgttgaagagtcaaatactcttcctccatgggttatgcattcc
ttttcagaggcaaaggtcaaagagttggttaaagcaaatggaacctattcatttattgat
atgtttactagaaggcaacttagagtgtttccaaaaggtacgcgagtcaatagttcaaat
tatgatcctgttcctggatggaccatgggtgcacagattgttgctctcaaccaacaaaca
tcatctgaaccaatgtggctcaatgctggaatgtttgctgataatggtggttgtggatat
gtcctcaaatcaccatgtctcttgccgtcaaccgtttcaggtgaattcaattatttcgat
ccatcagagccaactcgtcatgcatcgtccaagtatagcaagttgattatcaacattatt
tctgctcgtcaacttccaaaatacacaaagaccgaaggaggtgaagtcattgatccattt
gtcacagtgtcaattcatggttcacaacttgatgatagggaattcaaaacaaaggttatc
gatgataatggtttcaatccatattggggagaagaatttgaattcccattgattcatgat
caagttgccatgttattaatcagagttgatgacaaggacaaattcaaacgtcaaaataga
attggtcactattgtatcaaggtatcaaatatcagaaatggttatcgtgtcattaaatta
gaaaatggatatggtaatcaaatcccaatgtgtaacttgttatgtaagtttaccttggtt
ccaaattag

DBGET integrated database retrieval system