KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_07550Help
Entry
DFA_07550         CDS       T02668                                 

Gene name
celA
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DFA_07550 (celA)
Enzymes [BR:dfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     DFA_07550 (celA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 622 aa AA seqDB search
MNIHKNKSIWCTIALFLVLFSQSINGQSTDYCDYLKNALLFYKMNRAGRLPDNDIPWRGN
SVLKDASPGSSPNAQGDGNLAGGYFDAGDGVKFALPMTYSMTMLAWAFIQYESNVEKCGL
TNLYLETIKYGTDYFIAAHTSANEFAGQVGDGNLDHSYWGPPESMTMNRPVYMLTASNPG
TEVAMEASAALSAASIIWKTRDPAYAATCLTHAKQLHNFGDTYRGKYSDSIPNAQAFYNS
WSGFNDEIVWGTLWLYKATGDASLLTKAKSDYSTFGIGGMAQGNSHDWDLKAPGAALLMY
QLTKEATYQKDIEGFLNYWAPGGGITYTPGGMAWIRQWGPARYTATSAFLASVYGGSKYQ
TFCKSQISYILGNNPKQQSFVVATDYNAGFVGALASLVDPDGTPAPTTAPTTAPTTAPTT
APTTAPTTAPTTAPTTAPTTAPTTAPTTAPTTAPTTAPTTAQLQHQPLWAQHNMKDTRNK
NTGANSISFDPINWGALYFACQGCVDTSASTAISFYINGGSAGAQKLQVALVKNGSPIKT
KSLSDLIGKSLPANTWTKVSLKFTDFGATGSIDGLWIQDTNGAQQATVYVDDIVIESGNG
ATQTPTPTTKPTTTPKPTCKPN
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccataaaaacaaatctatttggtgtactatagcactatttttagtattattc
tctcaatctatcaatggtcaatcaactgattattgtgattatttaaagaatgctctatta
ttttacaagatgaatagagctggtcgtttaccagacaatgatatcccatggagaggaaac
tctgtattgaaggatgccagtccaggttcatctcccaatgcccaaggtgacggtaacctt
gccggtggctactttgatgccggagatggagtcaagtttgctttaccaatgacctactcg
atgaccatgttggcctgggcttttatccaatacgaatccaacgttgaaaagtgtggtctt
accaacttgtaccttgaaaccatcaagtatggtaccgactattttatcgctgcccacacc
tctgccaatgagtttgccggtcaagtcggtgatggaaacctcgatcactcttactggggt
ccaccagaatcgatgaccatgaaccgcccagtctacatgctcactgcctccaatccaggt
actgaagtggctatggaagcctctgctgctctctctgccgcctctatcatttggaagacc
cgtgatccagcctatgccgccacttgtctcactcatgccaagcaattgcacaactttggt
gacacttaccgtggaaagtactctgactctattccaaatgctcaagctttctacaactct
tggtctggattcaacgacgaaatcgtatggggtactttgtggctctacaaggctactggt
gatgcttcactcctcaccaaggccaagtctgactacagcacctttggtatcggtggtatg
gcccaaggaaactctcacgattgggatctcaaggctccaggtgccgctctcctcatgtac
caactcaccaaagaagccacctaccaaaaggatatcgaaggcttcctcaactactgggct
ccaggtggtggaatcacctacaccccaggtggtatggcttggattcgtcaatggggtcca
gctcgttacactgccacttctgctttcttggcctctgtctatggtggttccaagtaccaa
accttttgcaagagccaaatcagctacattctcggtaacaaccccaagcaacaatcattc
gtcgtcgctactgattacaatgccggtttcgttggtgctcttgcatcacttgttgatcca
gatggaactcctgctccaactacagctccaaccacagctccaactacagctccaactaca
gctccaaccactgcaccaaccactgcaccaactacagctccaactacagcaccaaccaca
gcaccaaccacagcaccaactacagccccaaccactgcaccaactacagccccaaccact
gcccaactacagcaccaaccactttgggctcaacacaatatgaaggatactagaaacaaa
aacactggtgccaactctatttcctttgatccaatcaactggggtgctttatactttgcc
tgtcaaggatgtgtcgatacatctgcctcgactgccatatcattctacattaatggtgga
agtgccggtgctcaaaaattacaagttgccctcgtcaagaatggtagcccaatcaagacc
aagtcactctctgacctcattggaaagagtctcccagccaacacttggaccaaggtatct
ctcaagtttactgactttggtgccactggatcgatcgacggtctctggatccaagacact
aatggtgctcaacaagctacagtctatgttgacgacattgtcattgaatctggtaatggt
gctactcaaactccaacccctaccaccaagccaactaccactccaaagccaacttgtaaa
ccaaattaa

DBGET integrated database retrieval system