KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_07957Help
Entry
DFA_07957         CDS       T02668                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Brite
Enzymes [BR:dfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DFA_07957
Peptidases [BR:dfa01002]
 Cysteine Peptidases
  Family C86
   DFA_07957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 292 aa AA seqDB search
MISKRMKWVTREVYEYLYMSSSSNQVYFERQKLKLCGLHTINNLLQRKAYTQSDLDSISY
EIDVSGRLINPHKSVFGWGNYDANVLVVALGRLGYEVKWFDKRLPIDNINFNEIYGLIVN
TKTTKFLGLWNSRHWFAIKNMKMNDNDNNNSIDNNNNNKNQIQCEYSIFNSECYHPEQLN
SFDKLKTFLEPVLNDKAGELLLVYNNNNNNNNNNNNNNNNNNNTDEIFNVVHIYNEYLYN
KYLIQKGSPKRPIVVDLADGSTDGLDDLDDLVLFRNLFNSSIGQVVYQTDLS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaaagagaatgaaatgggtaacacgtgaggtgtatgaatacctatatatgtca
tcatcatcaaatcaagtatactttgaaagacaaaagttaaaattatgtggacttcatact
attaataatcttttacaacgtaaagcatatacacaaagtgatttagatagtatatcatat
gaaatagatgtttcaggtagactgattaatccacataaaagtgtttttggatggggaaat
tatgatgcaaatgtattggttgtagcattgggtagattaggatatgaagttaaatggttt
gataaaagattaccaattgataatattaattttaatgaaatatatggattgattgtaaat
acaaaaacaacaaagtttcttggattatggaactctaggcattggtttgcaatcaaaaat
atgaaaatgaatgataatgataacaataatagtatagacaacaacaataacaacaaaaat
caaattcaatgtgaatatagtatattcaattcagagtgttaccatcctgaacaattgaat
tcatttgataaattaaaaacattcttggaaccagtattaaatgacaaggctggtgaatta
ttacttgtatataataataataataataataataataataataataataataataataat
aataataatactgatgaaatattcaacgtcgtccacatctacaacgagtacctctacaac
aagtacctcatccaaaagggttcaccaaaaagaccgatagttgttgacttggcagatggt
tcgacagatggcttggatgacttggatgacttggttctctttagaaatctctttaactcc
tccattggccaagtcgtctaccaaacagatttatcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system