KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_07977Help
Entry
DFA_07977         CDS       T02668                                 

Gene name
catA
Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Peroxisome
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DFA_07977 (catA)
  Amino acid metabolism
   00380 Tryptophan metabolism
    DFA_07977 (catA)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    DFA_07977 (catA)
Enzymes [BR:dfa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     DFA_07977 (catA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 601 aa AA seqDB search
MSQPILTTSNGAPVDNNLNSVTAGVNGPILIQDFHLIDKLSHFDRERIPERVVHAKGAGA
HGYFEVTNSDIPKWCRAKLFNKVGKRTPLFTRFSTVGGEKGSSDSARDPRGFAVKLYTEE
GNWDMVGNNTPVFFIRDPSKFPDFIHTQKRNPQTNLKDANAFWDFASLSPETTHQFTILF
SDRGTPKTYRHMDGFSSHTLKWVNAEGKAYWVKMHFKTESGIQNHTAEEAEQMDSKDPDS
ATRDLFESIAKGGEPAWKVWPHKDYPLIPIGRMVLNRNPENYFAEVEQAAFSPSHMVPGI
EPSPDKMLQGRLFSYPDTHRHRLGVNYQQIPVNCPYAVKGGVKNYQRDGAMAVNGNQGKA
PNYHPNSFGGPDVQPDAAIHQFPVAGSAGRFQYPPSDDFVQPGNLYRLMDEGAKTRLVGN
IVGHMKGVTVRDIQLRAISNFYKADKDYGTRIAKGLGIDINDVVKFSSRSNFNYEDKKYC
ITETKSQCIPQQDIYKFVNFNIEGPFDNNLYFGSVKNIANIPMMYFSIKLNNDSVVEGIK
NIFYDDVDGFLFANQTFSQHFLPGQHYTFSFGATNLKTYFVSEIGFNVVREEKEMERIKE
I
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaccaattcttaccactagtaatggtgcaccagttgataataacctcaactct
gtcactgccggtgtcaacggcccaatcttgattcaagatttccacttgattgacaagttg
tctcactttgatcgtgagagaatcccagagcgtgtcgtacatgccaagggtgccggtgct
cacggttactttgaagtcaccaactcagacattccaaagtggtgtcgtgccaagttgttc
aacaaggttggcaagagaaccccactctttactcgtttctctactgtcggtggtgaaaag
ggttcctctgacagtgccagagatccacgtggtttcgccgtcaaattatataccgaagaa
ggtaattgggatatggttggaaataatacaccagtatttttcattcgtgacccaagtaaa
ttcccagactttattcatacacaaaagcgtaatccacaaaccaatttaaaggatgccaat
gccttttgggattttgccagtttgtcaccagaaactactcatcaattcaccattttgttc
tctgatagaggtacaccaaagacctatcgtcacatggatggtttctcgtcacacacactc
aagtgggtcaatgccgagggcaaggcatactgggtcaagatgcatttcaagaccgagagt
ggtatccaaaaccacactgccgaggaggccgagcagatggactccaaggacccagactct
gccacccgtgacctctttgagagtatcgccaagggcggcgaaccagcctggaaggtgtgg
ccacacaaggactacccccttattccaatcggtcgtatggtgttgaaccgtaacccagaa
aactactttgccgaggttgagcaagctgccttttcgccatcacacatggtaccaggtatc
gagccatccccagacaaaatgctccaaggtcgtctattctcctacccagatacccaccgt
caccgtctcggcgtcaactaccaacaaatcccagtcaactgtccatacgccgtcaagggt
ggtgtcaagaactaccaacgtgatggtgccatggctgtcaatggcaaccaaggaaaggcc
cccaactaccaccccaactcgtttggcggtccagacgtccaaccagacgctgccatccac
caattcccagtcgctggcagtgccggtcgtttccaatacccaccaagcgacgactttgtc
caaccaggtaacctctaccgtctcatggacgaaggtgccaagacccgtctcgttggcaac
atcgtcggtcacatgaagggtgtcactgtccgtgacatccaactccgtgccatctccaac
ttttacaaggccgacaaggattacggtacccgtattgccaagggtctcggtattgatatt
aatgatgtagtaaaattctcttctagatcaaactttaattatgaagataaaaaatattgt
atcactgaaactaaatcacaatgtattccccaacaagatatttataaatttgtaaacttt
aatattgaaggaccatttgacaataatttatattttgggtcggtaaagaatattgccaat
attccaatgatgtattttagtataaagttaaacaatgatagtgtagttgagggaatcaag
aatattttctatgatgatgtcgatggattcctgtttgccaatcaaaccttttcccaacat
ttcctacctggtcaacattatacattctcatttggtgctaccaatttaaaaacttacttt
gttagtgaaattggttttaatgtagttagagaagaaaaagaaatggaaagaattaaagaa
atttaa

DBGET integrated database retrieval system