KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_08980Help
Entry
DFA_08980         CDS       T02668                                 

Gene name
erkB
Definition
extracellular response kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 385 aa AA seqDB search
MASSEDIDKHVLRKYEVLQKLGKGAYGIVWKAIDKKTKDVVALKKIFDAFQNATDAQRTF
REIMFLQELYGHENLIKLLNVVKADNDRDIYLVFEYMETDLHAVIRANILEDIHKQYTIY
QILRALKYMHSGNVLHRDIKPSNLLLNSECLVKVADFGLARSIASLENVTEANPVLTEYV
ATRWYRAPEILLGSTKYTKGVDMWSIGCILGELLGGKAMFPGNSTMNQLDLIIEVTGRPT
PEDIEAIKSPFAATMLESLPPTNPRSLSEMYPHASPEALDLLRRLLQFNPDKRITAEEAL
LHPYVSQFHNPTDEPSTDRIIKLPIDDSQKYPISEYRNKLYNDIIKKKKETRRRQASSSR
ASGDGDSQMSNSSSSAPAFPAVQPV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagtgaagacattgataaacatgtactcagaaaatacgaagtattacagaaa
ttaggtaaaggtgcatatggtattgtatggaaagcaattgataaaaagacaaaagatgtt
gtagcattaaagaagattttcgatgctttccaaaatgcaacagatgctcaaagaacattt
agagaaatcatgttccttcaagaattatatggacatgagaatttaatcaaactattaaac
gttgttaaagctgataatgatagagacatttatttggtatttgaatatatggaaactgat
ttacatgcagtgattagagccaatattctagaggatatacataaacaatatacaatctat
caaatactgcgagctctaaagtatatgcacagtggaaatgtgttgcatcgtgacattaag
ccatcgaacctcttgctcaacagcgagtgtttggttaaagtggccgactttggtttggca
cgtagcattgcgtcgttggagaatgtgaccgaggcaaacccggtcttgacagagtacgtt
gccactagatggtaccgtgcacccgagattttactcggctctaccaaatacaccaagggt
gtcgacatgtggtcgatcggatgtatccttggcgagttgcttggtggcaaggccatgttc
ccaggcaacagcaccatgaaccagttggatcttattatcgaggtcactggccgtcccaca
ccagaggatattgaagccatcaaatcaccatttgcggccaccatgctcgagtcgttacca
ccaaccaacccaagatctctgtctgagatgtacccacacgcttcaccagaagctttggac
ctactccgcagactactccaattcaacccagacaagcgtatcaccgccgaggaagctctc
ctccacccatacgtctcacagttccacaaccccaccgacgaaccatcgaccgatcgtatc
atcaagctccccatcgacgacagtcaaaaatacccaatttcagagtaccgtaacaaactc
tacaatgatattataaaaaagaaaaaggaaaccagaagacgccaagcttcctcttcccga
gcatctggagatggagatagtcaaatgtcaaattcttcttcttcagctccagcttttcct
gcagttcaaccagtttaa

DBGET integrated database retrieval system