KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_08980Help
Entry
DFA_08980         CDS       T02668                                 

Gene name
erkB
Definition
extracellular response kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Brite
Enzymes [BR:dfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     DFA_08980 (erkB)
Protein kinases [BR:dfa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   DFA_08980 (erkB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 385 aa AA seqDB search
MASSEDIDKHVLRKYEVLQKLGKGAYGIVWKAIDKKTKDVVALKKIFDAFQNATDAQRTF
REIMFLQELYGHENLIKLLNVVKADNDRDIYLVFEYMETDLHAVIRANILEDIHKQYTIY
QILRALKYMHSGNVLHRDIKPSNLLLNSECLVKVADFGLARSIASLENVTEANPVLTEYV
ATRWYRAPEILLGSTKYTKGVDMWSIGCILGELLGGKAMFPGNSTMNQLDLIIEVTGRPT
PEDIEAIKSPFAATMLESLPPTNPRSLSEMYPHASPEALDLLRRLLQFNPDKRITAEEAL
LHPYVSQFHNPTDEPSTDRIIKLPIDDSQKYPISEYRNKLYNDIIKKKKETRRRQASSSR
ASGDGDSQMSNSSSSAPAFPAVQPV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagtgaagacattgataaacatgtactcagaaaatacgaagtattacagaaa
ttaggtaaaggtgcatatggtattgtatggaaagcaattgataaaaagacaaaagatgtt
gtagcattaaagaagattttcgatgctttccaaaatgcaacagatgctcaaagaacattt
agagaaatcatgttccttcaagaattatatggacatgagaatttaatcaaactattaaac
gttgttaaagctgataatgatagagacatttatttggtatttgaatatatggaaactgat
ttacatgcagtgattagagccaatattctagaggatatacataaacaatatacaatctat
caaatactgcgagctctaaagtatatgcacagtggaaatgtgttgcatcgtgacattaag
ccatcgaacctcttgctcaacagcgagtgtttggttaaagtggccgactttggtttggca
cgtagcattgcgtcgttggagaatgtgaccgaggcaaacccggtcttgacagagtacgtt
gccactagatggtaccgtgcacccgagattttactcggctctaccaaatacaccaagggt
gtcgacatgtggtcgatcggatgtatccttggcgagttgcttggtggcaaggccatgttc
ccaggcaacagcaccatgaaccagttggatcttattatcgaggtcactggccgtcccaca
ccagaggatattgaagccatcaaatcaccatttgcggccaccatgctcgagtcgttacca
ccaaccaacccaagatctctgtctgagatgtacccacacgcttcaccagaagctttggac
ctactccgcagactactccaattcaacccagacaagcgtatcaccgccgaggaagctctc
ctccacccatacgtctcacagttccacaaccccaccgacgaaccatcgaccgatcgtatc
atcaagctccccatcgacgacagtcaaaaatacccaatttcagagtaccgtaacaaactc
tacaatgatattataaaaaagaaaaaggaaaccagaagacgccaagcttcctcttcccga
gcatctggagatggagatagtcaaatgtcaaattcttcttcttcagctccagcttttcct
gcagttcaaccagtttaa

DBGET integrated database retrieval system