KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_09131Help
Entry
DFA_09131         CDS       T02668                                 

Gene name
pdi1
Definition
protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    DFA_09131 (pdi1)
Enzymes [BR:dfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     DFA_09131 (pdi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 377 aa AA seqDB search
MTVINIFGILKDESIENGMNMNKIILLALFAVIVACVAADGNVVDLKPDTFDSVVDGSKS
VFVKFYAPWCGHCKKMAPDYEIIADTFAGSKQVVVAKVNCDDHKELCSKHGVNGYPTLKM
YAKSTTAKDYNGGRSIDEIITFINGAAGTNVRVKKAASNVIDLDDSNFEKIALDEDKHVL
VEFYAPWCGHCKKLAPDYEVLANTFANDKDVEITKVDCDAHKDLCSKYGISGFPTLKWFP
KNNKEGEKYEQGREVDTFISFINKNAGTLRVKGGRLLATAGRIEKLDEIAAKFVDATAAV
KKELIVAAKKIVDTLTAEVKDQGKLYVKIMENIEKASDYATKEVARVTKILAGSVPAKKL
DDFSKKLNVLDAFSKKE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcatcaatatatttggtattctcaaagatgaaagcatcgagaatggaatgaat
atgaacaagatcattttattagcattatttgctgttattgttgcatgtgttgcagctgat
ggcaacgtggttgatttgaagccagacacttttgatagtgttgtcgatggtagcaagtcg
gtgtttgtcaaattctatgctccatggtgtggtcattgcaagaagatggctccagactat
gagatcattgccgacacttttgccggcagcaagcaagtcgtcgttgccaaggtcaactgt
gacgaccacaaggaactctgctccaagcacggtgttaacggatacccaaccctcaagatg
tacgccaagtcaaccactgccaaggactacaacggtggcagatcgatcgacgagatcatc
acctttatcaacggtgccgccggtaccaacgtccgtgtcaagaaggctgcctccaacgtc
atcgacttggatgactccaactttgaaaagattgccttggacgaagacaagcacgtcttg
gttgagttctatgctccatggtgtggtcactgcaagaagttggctccagactacgaagtc
cttgccaacacctttgccaacgacaaggatgtcgaaatcaccaaggttgactgtgacgcc
cacaaggacctctgctccaagtacggtatctctggtttcccaaccctcaagtggttccca
aagaacaacaaggaaggtgaaaagtacgaacaaggtcgtgaagtcgatacctttatctct
tttatcaacaagaatgccggtactctccgtgtaaagggtggccgtctcctcgctaccgcc
ggtcgtatcgaaaagttggacgaaatcgccgccaagtttgtcgacgccaccgccgccgtc
aagaaggaattgatcgtcgctgccaagaagatcgtcgacactttgaccgctgaagtcaag
gaccaaggcaagctctacgtcaagatcatggaaaacatcgaaaaggcctctgactatgcc
accaaagaagttgcccgtgtcaccaagatcctcgctggttccgttccagccaagaaactc
gatgacttttcaaagaagctcaatgtcttggatgctttctccaaaaaggaataa

DBGET integrated database retrieval system