KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_10059Help
Entry
DFA_10059         CDS       T02668                                 

Gene name
amyA
Definition
putative alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DFA_10059 (amyA)
Enzymes [BR:dfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DFA_10059 (amyA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 470 aa AA seqDB search
MKSLSIIIISIILSIFIRCNDAATPLQWSSRIIYQLLTDRFALSNNADTPCPDISTYCGG
TFQGIGQHLDYIQGMGFDAIWISPVITNYPGGYHGYWQTDIYSINSNFGTSQDLLNLIQE
CHARDIWVMLDVVANHIGPVGYDYTTINPFNQDEHYHDCSSCPSQCTISDFNDQPQVEIC
RLAGLPDLDQNNTFVRETLVSWIHNITQFYGFDGIRVDTVPEVQQDFWSDYCQAADMYSV
GEVYNGDVQYVAPYQQYLDGLLSYPLFFVLRNVFEQQQSMYNIQSMMQQYQASFGNLSYL
GTFIDNHDQPRFLNGQSDMQLYKNAITYVLTAVGIPIIYYGTEQGFNGASDPDNREPLWP
SGFNNQTDLYQFIKTVNQFTKQVSISQYPQIQRYADDTFYAYTRGDVFVALTNGGSNQGQ
ISRNITYQPYPDNTVLCNIFWETEDCIKVVNGQFEVFLDQGESKIYHPIT
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctctatcaattataattatatctataatattatcaatatttatacgatgcaac
gatgcagcaacacctttacaatggagttcaagaatcatctatcaattgctaactgataga
tttgctctatcaaacaatgccgatacaccatgccccgatataagcacctattgtggtggt
acattccaaggtattggtcaacatttagattatattcaaggaatgggttttgatgctatt
tggatttcacctgtcattacaaattatcctggaggatatcatggatattggcaaacagat
atttattcaattaatagtaattttggtacaagccaagatttattaaatctcattcaagag
tgtcacgctcgtgatatttgggtcatgttggatgttgtcgctaatcatattggcccagtt
ggttatgactatacaacaatcaacccatttaaccaagatgaacattatcatgattgttcg
tcttgtccatctcaatgtactattagtgattttaatgatcaaccacaagttgaaatatgt
aggttggcaggattaccagatttagatcaaaacaatacatttgtcagagagacgttggta
tcatggattcataatatcacccagttttatggattcgatggtataagagtagacactgta
ccagaagtacaacaagacttttggtcagactattgtcaagctgcagacatgtattcagtg
ggtgaagtgtacaatggtgacgttcaatacgttgcaccgtaccaacaatacctcgacggt
ctactaagttacccattattctttgtactgagaaatgtatttgaacaacaacaatcaatg
tacaatatccaatcaatgatgcaacagtatcaagcttcttttggtaatttatcatacttg
ggaacttttattgataatcacgatcaaccacgtttcctcaatggtcaaagtgacatgcaa
ctctacaagaatgcaatcacctatgtattgacggctgtcggtatccccatcatctactat
ggcaccgaacaaggattcaacggagccagtgatccagacaaccgagaaccactctggcca
tcaggattcaataatcaaaccgatctctaccaattcataaagacggtcaaccaattcaca
aaacaagtatccattagtcaatacccacaaatccaacggtatgccgacgacaccttttat
gcctacactagaggtgatgtctttgttgccctcaccaatggtggttcaaatcaaggtcaa
atttcaagaaatattacttatcaaccttatcctgataatactgttttatgtaatatattt
tgggaaacagaagattgtattaaagttgtaaatggacaatttgaagtatttttagatcaa
ggtgaatcaaagatttatcatccaattacataa

DBGET integrated database retrieval system