KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_11137Help
Entry
DFA_11137         CDS       T02668                                 

Gene name
redB
Definition
NADPH-cytochrome-P450 oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Brite
Enzymes [BR:dfa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     DFA_11137 (redB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 735 aa AA seqDB search
MIDQHRHHHRPDSSTTDRYRTSTSSYHQNMMDMIEELVNEYLPTIIVVAIIVCTYLYMNR
PPPPPPKRAVVTKPVKKPEVQSFKSKEKSLKIFFGTQTRTAEDFSRVLEKEAKKIGIPVD
VVDMELYDPEDLSSEYFVMFIVATHGEGDPTDNAKEFYLWLTSEDRQPASLSNVPFTVFG
LGNKTYEHYNAVARVIDRRMEELGGKRVSERGEGDDDATLEEDFIHWKKNMWPSVCEFLG
YELKSAEDDKFVPRFRMVNVDGEGQDISNPYIKVVPPRIKPKLDKDGKTVLYEMKNPYLA
TVVENRELHGVASDRSCRHVELDISGTSLSYTPGDHLGVFPVNDTELVEALITRLGVDGE
QIFALVPHDKAGRVVEASFGPVTIRKALHESFDITNPPRKAIIRALAEYTAVEEEKKRLL
QLASEEATDEYNNYIKHEFRSVVDLLVQFPGVQPPIAHFFELMPRIPARYYSISSSHSAT
PGRVTITSVVVNFVNGAKRLHNGVCSTWLSKLAPGSKVPIFVRESHFRLPPYFGGSKKTT
TTTTTTTTTTTTTISTNTVISSQLKSSSSLTKCPPIIMIGPGTGLAPFRGFLQEIKFKLQ
QQKSVEIAEAADQPALNTKVYFGCRRADVDYLYKEEIELYKSEGIIRDLSVAYSRAIDKK
VYVQHKLLEDSLSIWEALQQGAYIYVCGDARNMAKSVQQTLQQIIREHGGGDENASQSYI
DDLGKSGRYLQDVWF
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgattgatcaacatcgtcatcatcatcggcctgacagttcaacaacagatagatacaga
acatcaacatcatcataccaccaaaatatgatggacatgattgaagaattggtaaatgaa
tatttaccaaccatcatagtggttgcaatcattgtttgtacctacttgtatatgaataga
ccaccacctccaccaccaaagagagcagtagtcaccaaaccagtcaaaaaaccagaagta
caatcatttaaatcaaaagagaaatcattaaaaatcttttttggaacacaaactagaact
gcagaagatttttcacgtgttttggaaaaggaagccaaaaagattggtattccagttgat
gttgtcgatatggagttgtacgatccagaggatctatcaagcgaatactttgtcatgttt
attgtggctactcatggtgagggtgaccctaccgacaatgccaaggagttttatttgtgg
ttgacaagcgaagaccgtcaaccagccagtttgagcaacgtgccattcaccgtctttggc
ttgggcaacaagacctacgaacactacaatgcagtggcacgtgtgattgaccgtcgcatg
gaagagttgggtggaaagagagtgtcggagcgtggagaaggtgacgacgacgccaccttg
gaggaggatttcatccactggaagaaaaacatgtggccaagcgtatgcgaatttttgggc
tacgaactcaagtctgccgaggacgacaagtttgtaccacgtttccgtatggtcaacgtc
gacggcgaaggacaggatattagcaacccatacatcaaagtggtgccacctcgcatcaaa
ccaaagctcgacaaggacggcaagaccgtcttgtacgagatgaagaacccatacctcgcc
accgtcgttgagaatcgtgagttgcacggtgttgcatcggaccgttcgtgtagacatgtc
gagcttgacatttccggtacctcactctcttacacacccggtgatcatctcggtgtgttc
ccagtcaacgacacggagcttgtagaagcactcatcacacgtcttggcgttgatggcgag
cagatctttgccctcgtgccacacgacaaggctggtcgtgtcgttgaggcctcgtttggc
cccgtcaccatccgaaaggctctccatgagagttttgacattaccaacccaccccgaaag
gcaatcatccgtgccttggccgaatacactgccgttgaagaggaaaagaagcgtctgctt
caactcgccagcgaggaagcaaccgacgagtacaacaactacatcaagcacgagtttaga
tcagtcgtcgatctccttgtccagttcccaggcgtccaaccacccattgctcactttttc
gagttaatgccacgtatccccgcacgttactattccatctcttcgtcgcactcggccact
cctggtcgtgtcactatcacctctgtcgttgtcaactttgtcaacggtgccaaacgttta
cacaatggagtatgctcaacatggctctccaagctcgctccaggttccaaagtaccaatc
tttgttcgtgaatcacattttagattaccaccatattttggtggcagtaaaaagactact
acaactaccactaccacaactactacaactacaacaaccatttcaaccaatacagttatt
agtagtcaattaaaatcatcttcatcacttacaaagtgtccaccaattattatgattgga
ccaggaactggtttagctccatttagaggattccttcaagaaatcaagtttaaactccaa
caacaaaagagtgtagagattgcagaagctgccgatcaaccagcactcaacaccaaggta
tactttggatgtcgtcgtgccgatgtcgattatctctacaaggaggaaatagaactttac
aagagcgaaggtatcattagagatttaagtgttgcctactctagagccatcgacaaaaag
gtctatgtccaacacaagctcttggaagacagtctatcgatttgggaggctctacaacaa
ggtgcttacatctatgtttgtggtgatgctcgtaatatggccaagagtgttcaacaaact
cttcaacaaattattcgtgaacatggtggtggtgatgaaaatgcttcacaatcttatatt
gatgatcttggtaaatctggtcgttatttacaagatgtttggttctag

DBGET integrated database retrieval system