KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_11618Help
Entry
DFA_11618         CDS       T02668                                 

Gene name
cyb5r1
Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dfa00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 328 aa AA seqDB search
MNTPPPFPSKQLIARSYKVFAEPFVLARLDPTLRIAQRLYKMFTELFSMNAEAKIGLFVA
AVAALLGVKFLFANNTSVPSESKKESKPALDAKEYKKFKLQKKIIVNHNTRIFRFELPNA
TDRLGLPIGQHISLRATVNGKEVYRPYTPISSDDDLGYFDLLIKVYEKGQMTTFVDNLFV
GDSIDVKGPKGLFNYKPNMFKHIGMLAGGTGITPMLQVIKAIVSNPEDKTKVSLVFGNIT
EEDILLKKELDQVSENYPNISIYYVLNNPPQKGWTQGVGFISQDIIQQQLPAPSEGVKVC
LCGPTVMNKAMTGHLLALNFKEEDIFTF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaccgccaccatttccctcgaaacaattaattgcaaggtcatacaaagtattt
gctgaaccttttgttcttgcaagactcgatccaactttgagaattgcacaaagactctac
aagatgtttaccgaattatttagtatgaatgcagaggcaaagattggtttgtttgtagct
gccgttgctgcccttttaggtgtcaagtttttatttgccaacaatacttctgttccatct
gaatccaagaaggaatcaaagcctgcattggatgcaaaggaatataaaaagtttaagctc
caaaaaaagatcattgttaaccataacactcgtatctttagattcgagcttccaaacgca
actgatcgtcttggtctcccaattggacaacacatttctctccgtgccaccgtcaatggc
aaggaagtctaccgtccatacaccccaatctcgtcggacgacgatcttggatactttgac
cttttgatcaaggtctatgaaaagggacaaatgaccacctttgtcgacaacctctttgtc
ggtgactcgatcgatgtcaagggtccaaagggtctctttaactacaagccaaacatgttt
aagcatattggtatgttggccggtggtactggtatcactccaatgctccaagtcatcaag
gctatcgtatccaacccagaagacaagaccaaggtttctttggtatttggtaacatcacc
gaagaagatatcctcctcaaaaaggaattggatcaagtctctgaaaattatccaaatatt
tcaatttattatgttttgaataatccaccacaaaagggatggactcaaggagttggtttc
atttctcaagacattatccaacaacaattgccagcaccaagcgaaggtgtcaaggtttgt
ttgtgtggtccaactgtcatgaacaaggctatgaccggtcacttattagctcttaacttt
aaagaagaagatattttcactttctaa

DBGET integrated database retrieval system