KEGG   Dictyostelium fasciculatum (cellular slime mold): DFA_11886Help
Entry
DFA_11886         CDS       T02668                                 

Gene name
pikA
Definition
phosphatidylinositol-4,5-diphosphate 3-kinase
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dfa  Dictyostelium fasciculatum (cellular slime mold)
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dfa00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dfa04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1473 aa AA seqDB search
MTPKPTTSLEMINNNNNNTSSSSKNEENGSTQQQQQQSPKLNSSTDSSSGDEELKQIYKT
KKLEFHALAQSKKYDRSLLVLEKKGLVKEISAKFQTPDTASFTKINPHTHQSIVERIAYL
KKENERKKADFEMTRRERVIQLDDIELSSTQDELRERLYGRKKDDVITVSSILNSSSSTS
SPNNTTSSTTPWKKNDSGDSNAAAAVVSTTISTTTSSTSTTSSSKASSKIIGRRRRDDKS
LPSFKEANTFNLQNYLSVSPVAVVAKPTLPPLAISSDCKQYLKNIILSNTGKEIVSIEHF
SSSTPDRSNNQSSSSSSSNSSFLSSSPPVGSSSSSSMMMMNTTTALRMKALQASFQIQFI
LPNQSSVSLPCKGNETVESVKEKLMQVLESQRIQLSKQQQQQSQQSQQSLSPDTKDNNNN
NNGTVKIKKFESDSYLIMDIENRPLEKSLSLNKCEYILEKRARSLIPKLKLVEKSNYYDA
HPKEELSGADYEIITKILPKSTSWKGEEVDSFRRVAARLRYDLLGDIKGAVCHSLSVRLS
PLPLPFVPGKILISVFLPILQVTKTLELESGETADLFLERLFFKNYSKHLPNVTSSDFIL
KVMGCSDYVHGPHDLKTFEYIRKCILQGTKTQLVLIQRPKIELDVPPFKQRFNFAPELPI
NFEVGQYSSKSLHWEDLTHILIRDIKKPLKIKVLGAYNIPTSYLNKDDDNISVIVSMSLY
HGLECLGQTSTGIEPIIPPSFFNNNNVSLNSSSSSSPPTLLHTNSSLSLKDLDTNNNNQN
NNNTNNNNVQSNSSLSSSTSSTNISTLNVQWNEQVIFTNMDYSNLPKETRLCISLYATKS
SSSSTTSSSSSSSSSSSTNNNNEMEPDLKKDFPIGWVNLTLCDYNYQLRNGILELKLWPD
DVANPIATCVANSQSSTAVSLFIEFEQFALPVIFPSINHHVPNVEPPTINSKDMRDFFEY
VIKLDPLSEMAHEKYQQLWALRHYAMLFPQVLPRLMLSVPWNNPACVDEIHSFIDRWPRL
KAYDALELLDAKHADRNVREYAVSCLDDLPEEELLDILLQLIQILKVEPYHDNMLARFLL
RKAILNRSIGHSFFWYLKSDLHVEGVAERFGLYLESYLHSCGTHRQELLRQIQVIDGLTE
VAKKIKPLKDQDRREVMIRELEAFDWPKRFQITLNPRFESNGLITSKCKYMDSKKLPLKL
SFTNIDMGAEPIEIIFKVGDDLRQDMLTLQMIRLMDKLWQKEGLDLKLSPYGCIATGDMI
GMIEVVLNSETTARIQKTAGGATAAFKLDPLANWLHEHNKTDAEYQKAVDTFILSCAGYC
VATYVLGIGDRHNDNLMCTKLGRLFHIDFGHFLGNYKKKFGFKRERAPFVFTPDFCYVMG
GKESPKFVQFVNYCCTAYNILRRHAKLFMNLFAMMVSTGIPELQSMDDLNYLQESFSLEL
SDEKAREKFIGLIHESLTTKTTQVNNYVHLLVH
NT seq 4422 nt NT seq  +upstreamnt  +downstreamnt
atgacaccaaaacctactacatctttagagatgataaataacaacaataataatacaagt
agtagtagtaagaatgaagagaatggatcaacacaacaacaacaacaacagtcaccaaag
ttaaattcaagtactgatagtagtagtggagatgaagaattgaaacaaatctacaagaca
aagaaactagagtttcatgcattggcacaatctaaaaagtatgatcgatcgttgttggtc
ttggaaaagaaaggattggtcaaggagatatctgccaagtttcagacacccgacactgca
tcgtttacaaagatcaaccctcatacacatcaatcgatcgtcgaacgaatcgcatacctc
aaaaaggagaatgaacgcaaaaaggcagactttgaaatgacccgtcgagagcgtgtcatt
caactagacgacattgaattgtcaagtactcaagatgaactacgtgaacgtctctatggt
cgtaaaaaggatgatgtcataactgtttcctctattctcaattcctcctcttctacttct
tcaccaaacaacactacgagttctactacaccatggaaaaagaatgattcaggtgattca
aatgctgctgctgctgtagttagtacaactataagtactactacttcaagtactagtact
acttcttcgtcaaaagcaagtagtaagattattggtagacgtagacgtgatgataaatca
ttaccatcgtttaaagaggcaaatacatttaatctacaaaactatttatcagtgtcgcct
gttgcggtggtggccaaacccactctaccacctcttgccatttcatccgactgtaaacaa
tatctcaaaaatatcatcctttccaacactggcaaggagattgtatccatagaacacttt
tcatcatctactcctgatcgttcaaacaaccaatcatcctcttcttcctcttccaactct
tcattcttgtcttcatcaccaccagttggttcttcttcttcttcatcgatgatgatgatg
aatacaacaacagcacttagaatgaaagctcttcaagcatctttccaaattcaattcatc
cttccaaatcaatcatcagtctctttaccatgtaaaggaaatgaaacagttgaatctgtc
aaagagaaattaatgcaagttttggaatcacaacgtattcaactttcaaaacaacaacaa
caacaatcacaacaatcacaacaatctctatcaccagatacaaaagacaacaacaacaac
aacaatggtacagttaaaattaaaaaatttgaatcagattcttatttaattatggatatt
gaaaatcgtcctttggaaaaatctctttctcttaacaaatgtgaatatatattagaaaaa
agagcaagatcattaataccaaaattaaaattggtagaaaaatcaaattattatgatgca
catccaaaggaggagttgtcgggagcagattatgaaattataacaaagattttaccaaaa
tcaactagttggaaaggtgaagaagtagattcgtttagaagagttgctgcaagattaaga
tatgatctgttgggtgatatcaaaggtgcagtttgtcattcactctctgttagactttca
cctttacctttaccttttgttcctggaaaaatattaatttctgtatttttacctatactt
caagttactaaaactttagaattggaaagcggagaaacagcagatttatttttagaaaga
ttattttttaaaaattattcaaaacatttaccaaatgtaacatctagtgattttatatta
aaagtaatgggatgttcagattatgttcatggtcctcatgaccttaaaacatttgaatat
attcgtaaatgtatattacaaggaactaaaactcaactagtattaattcaacgtccaaaa
attgaattggatgttccaccttttaagcaaagatttaattttgcaccagaattaccaatt
aattttgaagttggacaatattcatcaaaatcattacattgggaagatttgacacatata
ttgattagagatataaagaaaccattaaagattaaggttttgggtgcatataatattcca
acatcctatttaaacaaggatgatgataatatctcagtcattgtatccatgtcactttat
catggtttggaatgtttgggccaaacatctactggcattgaaccaatcatcccaccttca
ttctttaataataataatgtatcattaaattcatcatcctcttcttctcctcctacttta
ctacatacaaatagtagtttatctttaaaagatctagatactaataataataatcaaaat
aataacaatactaataataataatgtacaatcaaattcttcactatcatcatctacttca
tctacaaatatttcaacacttaatgttcaatggaatgaacaggttatttttacaaatatg
gattattccaatttaccaaaagagactcgactttgcattagtttgtatgcaactaaatcc
tcttcttcctctacaacttcatcctcatcttcatcatcttcttcttcatcgactaataac
aacaatgaaatggaaccagatttaaagaaagatttcccaattggatgggttaaccttaca
ttgtgtgattacaactatcaacttcgaaatggtatactagagttaaagttgtggccagat
gatgtagccaatccaatagcaacgtgtgttgccaactctcagagctcgactgccgtctcg
ctgtttatagagtttgagcaatttgcattgccagtcatctttccttccatcaatcatcat
gtacccaatgttgaaccacctaccatcaactcaaaggacatgcgtgactttttcgagtat
gttatcaaactcgatccattgtcagagatggcacacgaaaagtaccaacaattgtgggca
cttcgtcactatgccatgttgttcccacaggtacttccacgtctcatgctcagtgtacca
tggaacaacccagcctgtgtcgacgagattcactcgtttattgaccgttggccacgtctc
aaggcgtacgatgcactcgagctactcgacgccaaacatgctgacagaaacgtacgcgag
tatgctgttagctgtctcgatgacttgcccgaagaagagttgctcgacattttactacaa
ctcattcagattctaaaggtcgagccgtaccatgacaatatgttggcacggttcctcctc
cgcaaggccattctcaaccgctcgattggtcattcattcttttggtacctcaagtcagac
ttgcatgtcgaaggtgttgctgagcgattcggactttacctcgagtcgtatttacactcg
tgtggtacgcaccgtcaggagttgctgcgtcaaatacaggtgattgacggattgaccgaa
gttgccaaaaagatcaaacctcttaaagaccaggatcgtcgcgaggtgatgatcagggaa
ctcgaggcatttgactggcccaagcgattccagatcacactcaacccacgctttgaatca
aacggacttatcacgagcaagtgcaagtatatggattcaaagaaactaccacttaaactg
tcgtttaccaatattgatatgggtgccgaacccattgaaatcatcttcaaggttggtgac
gatttgcgtcaagacatgttgacactacaaatgatccgtttgatggataaactctggcaa
aaggagggactcgatctcaagctctcgccatacggctgtattgctactggcgacatgatt
ggcatgatcgaggtcgttctcaactctgaaacaaccgcgcgtatccaaaaaacggctggt
ggcgcgaccgccgcctttaagctcgacccacttgccaactggctgcacgagcacaacaag
accgacgccgagtaccaaaaggccgtcgacacgtttatcctctcgtgtgccgggtactgt
gtggccacctatgtgctcggtattggtgatcgtcacaacgacaatctcatgtgcaccaag
ttgggacgtctcttccacattgattttggtcatttccttggcaactacaagaaaaagttt
ggattcaaaagagaacgtgctccatttgtctttacacccgatttctgttatgtcatgggt
ggcaaggagagtcccaagtttgtacagtttgtaaactattgctgcacagcctacaacatt
ctcagaagacacgccaaactctttatgaacctctttgccatgatggtctctacaggtatc
cccgaacttcaatccatggacgatttaaattatcttcaagaatcattctcgttggaattg
agtgatgaaaaggctcgtgaaaaattcattggtctaatccatgaaagtttaactaccaaa
acaactcaagttaataattatgttcatttattagttcattaa

DBGET integrated database retrieval system