KEGG   Desulfurococcus fermentans: Desfe_0201Help
Entry
Desfe_0201        CDS       T02136                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dfd  Desulfurococcus fermentans
Brite
Enzymes [BR:dfd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Desfe_0201
Transfer RNA biogenesis [BR:dfd03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Desfe_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(180823..182298)
Genome map
AA seq 491 aa AA seqDB search
MVPHPHPLKSGLMPAMLNIQVRKPSRMLSGITVVAVMTHPLPCPGECVYCPGGLGYNAPK
SYFGNEPAVRRARRNQFHPFKQVYERLRQYEALGHNPSKVEVIIMGGTFLALPESYKKWF
IANIYEACNTYPYGSPPLRVDLESAILRNETSRYRVVGLTIETRPDYGRERHADEMLHYG
ATKVELGVQSIYDDVLEIVRRGHNVKDTIESTRILRDAGFKICYHIMLGLPGSNPDRDIE
MVKELFTNPDFRPDMLKIYPTEVIEGTTLYTWWKEGKYKPYSDEDVIELVSEMYRYIPKY
VRIMRIRRDIPADEVAAGTRYANLREMIEKRAIEKGIEIQEIRFREAGLQMYKYGKTPDP
SRTNITRLTYEAGGGIEEFLAVEDTASNILIGFLRMRVPSEKAHRWEIDRDTAIIRELHI
YGPETPVGEKGVWFQHVGWGRKLVEKAEDIALNKYGVKKILVISGVGAREYYRRLGYFHP
PESPYMFKYLK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggttccacaccctcatccattgaagtcggggttgatgcctgcaatgctgaatatacag
gttagaaagccgtctagaatgctgagcggtataacagttgtagctgttatgacgcatccc
ctaccctgtcccggtgaatgtgtttattgcccaggtggactgggatataatgccccgaaa
agctattttgggaatgaaccagcggtgagaagggctaggagaaaccagttccacccgttt
aaacaggtatacgagaggttgaggcagtacgaggcactcggccataatccaagtaaggta
gaggtaataatcatggggggcaccttcctagccctcccggaatcctataagaaatggttt
atcgcaaacatatatgaagcatgtaatacctacccctatggaagcccacctttaagagtc
gacctagagtcagctatcctaagaaacgagaccagcaggtatagggttgtaggattaaca
atagagacaaggcctgattatggaagagaaagacatgcggatgaaatgctgcactatggg
gctacaaaggtcgagctaggtgttcaatcaatatatgatgatgtattagaaatagtgagg
agagggcataatgtaaaggatacaatagagtcaacacgaatacttagagacgccggcttc
aaaatatgctaccacataatgctcggtctaccaggtagcaatcctgaccgggatatagaa
atggttaaagaactattcaccaatcccgattttagaccggatatgctgaagatctacccc
accgaggtaatagagggaacaaccctctacacgtggtggaaagaggggaaatataaacca
tacagcgatgaagacgtcatagaattagtcagcgaaatgtaccgttacatacctaagtac
gttagaataatgagaatacgcagggatatcccagcagatgaggtggctgctggaacaaga
tatgctaatctaagagagatgatcgaaaagagggctattgagaaaggcatagaaatacag
gagataaggtttagggaggccgggctccaaatgtataaatatggtaaaacccctgatccc
agtagaaccaatataaccaggctgacatatgaggccggtgggggtatcgaggaattccta
gccgtggaggatacggcttcaaatatattaataggcttcctaagaatgcgtgtgccaagc
gagaaagcccatagatgggagatagacagagatactgctattataagagaactacatatc
tatggtcctgaaacgcctgtaggggagaaaggtgtatggttccaacacgtagggtggggt
aggaaattagttgagaaagccgaggatatcgccctgaataaatatggggttaagaaaata
ctcgtgataagcggtgtcggcgccagggagtactataggagactggggtatttccacccc
ccggagagcccatacatgttcaaatatcttaagtaa

DBGET integrated database retrieval system