KEGG   Desulfurococcus fermentans: Desfe_0233Help
Entry
Desfe_0233        CDS       T02136                                 

Definition
AMP phosphorylase (EC:2.4.2.-)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
dfd  Desulfurococcus fermentans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Desfe_0233
Enzymes [BR:dfd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Desfe_0233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
212023..213552
Genome map
AA seq 509 aa AA seqDB search
MGFESKSKLFNVKIIDLDLHRNLIIMNSDDAEELGVVTNNIVLVTAGDYSAYAMVITSKT
VTQPGVVALSTQTASALRVSEGDMVGVKPIGLPTSFNALKKRMSGVKLSESEMKSIIQDV
VNGIYGEAEIAAFLISQLYHELSEEELSYLVKAMVETGSKLVFEETVYDVHSIGGVPGNS
KVALITVPIVAASGLLIPKTSSRAITSPAGTADTMEVLARVDLTIDEIVEIARKVKGVLA
WGGKLNLAPADDIFVNIERRLSIDPEQQMVASILSKKLAMSVERLVIDIPVGRGAKVEKV
SLAEKLAGLFIRQAGLLGVTIRVALTYGGQPIGTSVGPALEAREALEALIERKGSRSLID
KAILLAGLVMELSGRVQPGQGEEVAREIFVSGKAYEKFKQIIEAQGGNPETKPSDIPIGS
HTYTLTSPLEGAVTHIDNTAISLIAKACGAPYDKRAGVKLHAKVGYRVNKGDPLITLYSD
SASRLETAVRLLRDLQPIIVEGMLLRTLP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggggtttgagagtaagtctaagctatttaatgtaaaaataattgacctggatttacat
aggaatttaattataatgaatagtgatgatgctgaggaattaggtgtagttacaaacaat
attgttttagttactgctggagactactcggcttatgcgatggttataactagtaagaca
gttacccaacccggtgtagtagctttatcaacgcagacggcttcggcgctaagggtttca
gaaggagatatggttggtgttaaacccattgggttaccgactagcttcaatgcgttaaag
aagaggatgagtggtgttaagctctctgagagcgagatgaagagtattatacaggatgtt
gtgaacgggatctatggcgaggctgagatagcggctttcctcattagtcagctctaccat
gagttaagcgaggaggaattaagctatcttgttaaagcaatggttgaaacggggagtaaa
ctcgtctttgaagagacagtatacgatgtgcatagtattggaggtgtacctggtaatagt
aaggtggctttgataacagtaccaatagttgccgcttcggggttattgatacctaaaacc
agtagtagagccataacgagcccggctggcacagctgatactatggaggtcttagctagg
gttgatctaacgattgatgagatagttgagatagctaggaaggttaaaggcgttctagcc
tggggaggtaagcttaatctggctccagcggatgatatatttgttaatattgaaagaagg
ctctccatagatcccgagcaacaaatggttgcaagtatattatccaaaaagctcgctatg
agtgtggagagactagtgatagatataccagtgggacgtggagcaaaggttgaaaaggtt
tctcttgctgaaaaactggcaggattattcataaggcaagccggtttactaggggttaca
ataagggttgccttaacctatggtgggcaacccataggtacatcagttggcccggcccta
gaggcgagagaagctctagaagcccttattgagagaaaggggagcaggagccttattgat
aaagccatactcctagctggattagttatggagttaagcgggagagttcagcctgggcag
ggtgaggaggtggctagggagatattcgtatccggtaaggcgtatgagaagtttaagcag
ataatagaggctcaaggagggaaccctgagaccaagccgagcgatatacccataggctct
cacacatatactctcacctcgccgcttgagggagctgttacacatatagataacactgct
atctctctaatagctaaggcgtgtggagccccctacgataaaagagctggcgtgaaactc
catgcaaaggtaggctacagggttaacaagggcgatccattaataacgttatatagtgac
agcgcgtcaagacttgagacagctgtgaggcttctaagagacctacagccaataatagtt
gaggggatgcttttaaggactctgccatag

DBGET integrated database retrieval system