KEGG   Desulfurococcus fermentans: Desfe_0502Help
Entry
Desfe_0502        CDS       T02136                                 

Definition
thiamine pyrophosphate TPP-binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
dfd  Desulfurococcus fermentans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:dfd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dfd00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dfd00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dfd00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dfd00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dfd00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:dfd00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:dfd00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(475128..476186)
Genome map
AA seq 352 aa AA seqDB search
MTVQTLPEFPVKKGEPAYKVWMFEPGWKGEIPLNFNLRQLAEQKRPVLLPGHRLCAGCAA
PLVVKLASFALRGPTIFVNATGCLEVATTIFPYTSWAAPWIHVAFENAAAVAGGVESAIK
ALKKTGRLPYDHVDVIVFAGDGGTFDIGFQALSGMAERGHDVLYILYDNEAYMNTGIQRS
GGTPQFASTTTSPAGEVIPGKTQAKKPIADIMVAHRIPYVATATPAHWMDFMKKVRRGLE
VNGPAFIHALSDCNRGWRHETDISVEIMRRAVDTCYFPLWEWTPEQGYMLTDRSLAIARN
PALKQPIEKYIEVQGRFRHLLKPENKELLKQFQEYVDKVWEDLLRRASNAPK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacggttcaaaccctgccagaattccctgttaaaaaaggcgagccagcatacaaggta
tggatgttcgaaccaggttggaagggcgagataccgttaaacttcaacctcaggcagctg
gccgagcaaaagaggccggtgctattacctggtcacaggctatgtgctggatgtgctgca
ccattggtagtaaagctagctagcttcgctctcagaggtcccacgatattcgttaacgcc
actgggtgtctcgaggtagcaaccacgatatttccctatacaagctgggctgcgccatgg
atccacgtagcattcgagaacgctgcggctgttgccggaggcgttgaatctgcaattaag
gcattgaagaaaaccgggaggttaccgtatgatcacgtggatgttatagtgtttgctggt
gatggaggaacctttgacataggattccaggctttaagcggtatggctgaaaggggtcac
gacgtattatacatactctacgataatgaggcctacatgaacaccggtatacagagatcc
ggtggaaccccgcaatttgcgtcaacaactacatcacccgccggtgaagtgataccaggt
aaaacacaggctaagaagccaatagccgatataatggtggcccatagaataccatatgtt
gctacagccacgccagcccactggatggatttcatgaagaaggttagaaggggcttagag
gttaatggtccggcattcatccatgcattaagcgattgtaaccgtggatggaggcatgaa
acagatatatcagtagagataatgaggagagcagttgatacatgctacttcccattatgg
gagtggacacctgagcagggatatatgttgacagataggagtctagcgatagctaggaac
ccggctttaaagcaacccattgaaaaatacatcgaggtccaaggtaggttcagacactta
ttaaagccggagaacaaggagctattaaaacaattccaggaatacgttgacaaagtatgg
gaagacctcttaagaagggccagtaatgcaccaaagtag

DBGET integrated database retrieval system