KEGG   Desulfurococcus fermentans: Desfe_0557Help
Entry
Desfe_0557        CDS       T02136                                 

Definition
Aldehyde ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
dfd  Desulfurococcus fermentans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:dfd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dfd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dfd00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523017..524969
Genome map
AA seq 650 aa AA seqDB search
MNTRRYRALFIDASTRKHWVEEYELNEVYSPISLGLKLHMERYKSWGKPIYHPDNALILG
AGLFTGSKMYGVHRFVAVFRSPLTKGLHVSEMGGAAFQFKINADAVVIVGRSETPLIVKI
YDQGDGEPVVEFHEIQEETLEHIWKGYGGFKGIYALQQYLSDHFKGFYEEFNGRSILVGP
ASKYTNIGALASVTLNKGRMDYGSEDFAARAGGGSILYRAHGVAAIIYGGRYDRSTKVPM
ELSDTRELDKLFMELTKQPYTQAVINAGAKYRYDPKLNTGGTLGGNYPHLKATTPMFNWK
MIYLPKDLREKLHELIMKYMWEPFNREAIETRSWKTCGEPCPLACKKVRLGKYKSDYEPY
NGLGPIIGVLDIHEAEKVVELADAYGFDAIELGQIIGFLFEAMDKGLLRPEEIGLPGKPF
FDPASYSIEYARVNAELAVKIIEQLAFGSNPLLRLIGERGLRSAAKILDILYRERIIERK
TRFSDIPIYAAFGEEGHITPNYYWTPGLVAPLVVLGKYWTVYSGVFMEPEEFASKSIERA
IYEALIADMGLCRFHRGWAEKAIPVILEKYYGVEKPLEKIRELYKKIAEYQKLAGALPVF
WDSGKIIDFMALAAEEYGNVEWGGKFKVNKEAAAREWWERFYRKLEELTR
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcggagatacagggcgttattcattgatgcatcaactaggaagcactgggtt
gaggagtacgagttaaatgaagtgtactcgccgatatcgctaggacttaagcttcatatg
gagaggtataaatcatggggcaagcctatctatcaccccgataacgcattaattctcggg
gctggtttgttcactggatcaaagatgtatggcgtacatagatttgtagcagtgtttaga
agcccattaaccaagggattacatgtatccgagatgggtggtgctgcgttccagttcaag
attaatgctgacgcggtagttatagtgggtagatcggagacaccccttatagttaagatt
tatgatcagggtgacggcgagccggttgtagagtttcacgagatacaggaggagacgctt
gaacatatctggaaaggatacggcggcttcaaaggcatatacgcgctacagcagtacctt
agcgatcatttcaagggtttctacgaggagtttaacgggagatccatactggttggcccg
gcttccaagtatactaatataggtgctcttgcctcggtaacgctaaacaagggtaggatg
gattatgggagcgaggacttcgcggctagagctggaggcgggagtatactgtacagggca
catggggttgcagcaataatctatggaggtaggtatgatagaagcaccaaggtacctatg
gagctcagtgatacaagggagctcgacaagttattcatggagttaaccaagcaaccatat
actcaggcagtgattaatgccggtgcgaaatacaggtatgatccgaagctaaacactggt
ggtacactcggcggaaactatccacatctcaaggcaacgacacctatgtttaactggaag
atgatatacctgcctaaggatctaagagaaaagttacacgaattaatcatgaagtatatg
tgggagccattcaacagggaggccattgaaaccaggagctggaagacatgtggcgaacca
tgtccactggcatgcaagaaggtgaggttgggtaagtacaagagcgactacgagccatat
aatggattaggccccattataggggtactagacatacatgaagccgagaaagtggttgaa
ttagctgatgcatacggcttcgacgcaatagagctgggccagatcataggattcctgttt
gaagccatggataagggattacttagaccagaggagatagggctacccggtaagccattc
tttgacccggcatcatacagtatagagtatgcaagagttaacgcagagctagctgtaaag
ataattgaacaacttgccttcgggagcaatccattactccgcctcataggtgagagggga
ttgaggtcggctgccaagatactggatatattatatagggagaggataatagagaggaag
acaaggttcagcgatatacctatatacgctgcattcggcgaagaaggccatataacgcct
aactactactggacgcccggcctagtagccccactagtggttctaggcaagtactggacg
gtttatagtggcgtattcatggagccagaggagttcgcgtcaaaatccattgagagagcc
atatacgaagcattaatagctgatatggggctctgcaggttccataggggttgggctgag
aaagctataccagtgatactcgagaaatactatggtgttgaaaagccgcttgaaaagata
cgtgagctatataagaagatagcggaataccagaagctagctggggctctaccagtcttc
tgggattcagggaagataatagacttcatggctctcgcggctgaagaatatggtaatgta
gagtggggtggaaagttcaaggtaaataaggaggcagctgcaagagagtggtgggagcgc
ttctacaggaagcttgaggagttaaccaggtaa

DBGET integrated database retrieval system