KEGG   Desulfurococcus amylolyticus DSM 16532: Desfe_0557Help
Entry
Desfe_0557        CDS       T02136                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K11389  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
dfd  Desulfurococcus amylolyticus DSM 16532
Pathway
dfd00010  Glycolysis / Gluconeogenesis
dfd01100  Metabolic pathways
dfd01120  Microbial metabolism in diverse environments
dfd01200  Carbon metabolism
dfd01230  Biosynthesis of amino acids
Module
dfd_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desfe_0557
Enzymes [BR:dfd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     Desfe_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C
Motif
Other DBs
NCBI-ProteinID: AFL66458
UniProt: I3XR84
Position
523017..524969
Genome map
AA seq 650 aa AA seqDB search
MNTRRYRALFIDASTRKHWVEEYELNEVYSPISLGLKLHMERYKSWGKPIYHPDNALILG
AGLFTGSKMYGVHRFVAVFRSPLTKGLHVSEMGGAAFQFKINADAVVIVGRSETPLIVKI
YDQGDGEPVVEFHEIQEETLEHIWKGYGGFKGIYALQQYLSDHFKGFYEEFNGRSILVGP
ASKYTNIGALASVTLNKGRMDYGSEDFAARAGGGSILYRAHGVAAIIYGGRYDRSTKVPM
ELSDTRELDKLFMELTKQPYTQAVINAGAKYRYDPKLNTGGTLGGNYPHLKATTPMFNWK
MIYLPKDLREKLHELIMKYMWEPFNREAIETRSWKTCGEPCPLACKKVRLGKYKSDYEPY
NGLGPIIGVLDIHEAEKVVELADAYGFDAIELGQIIGFLFEAMDKGLLRPEEIGLPGKPF
FDPASYSIEYARVNAELAVKIIEQLAFGSNPLLRLIGERGLRSAAKILDILYRERIIERK
TRFSDIPIYAAFGEEGHITPNYYWTPGLVAPLVVLGKYWTVYSGVFMEPEEFASKSIERA
IYEALIADMGLCRFHRGWAEKAIPVILEKYYGVEKPLEKIRELYKKIAEYQKLAGALPVF
WDSGKIIDFMALAAEEYGNVEWGGKFKVNKEAAAREWWERFYRKLEELTR
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcggagatacagggcgttattcattgatgcatcaactaggaagcactgggtt
gaggagtacgagttaaatgaagtgtactcgccgatatcgctaggacttaagcttcatatg
gagaggtataaatcatggggcaagcctatctatcaccccgataacgcattaattctcggg
gctggtttgttcactggatcaaagatgtatggcgtacatagatttgtagcagtgtttaga
agcccattaaccaagggattacatgtatccgagatgggtggtgctgcgttccagttcaag
attaatgctgacgcggtagttatagtgggtagatcggagacaccccttatagttaagatt
tatgatcagggtgacggcgagccggttgtagagtttcacgagatacaggaggagacgctt
gaacatatctggaaaggatacggcggcttcaaaggcatatacgcgctacagcagtacctt
agcgatcatttcaagggtttctacgaggagtttaacgggagatccatactggttggcccg
gcttccaagtatactaatataggtgctcttgcctcggtaacgctaaacaagggtaggatg
gattatgggagcgaggacttcgcggctagagctggaggcgggagtatactgtacagggca
catggggttgcagcaataatctatggaggtaggtatgatagaagcaccaaggtacctatg
gagctcagtgatacaagggagctcgacaagttattcatggagttaaccaagcaaccatat
actcaggcagtgattaatgccggtgcgaaatacaggtatgatccgaagctaaacactggt
ggtacactcggcggaaactatccacatctcaaggcaacgacacctatgtttaactggaag
atgatatacctgcctaaggatctaagagaaaagttacacgaattaatcatgaagtatatg
tgggagccattcaacagggaggccattgaaaccaggagctggaagacatgtggcgaacca
tgtccactggcatgcaagaaggtgaggttgggtaagtacaagagcgactacgagccatat
aatggattaggccccattataggggtactagacatacatgaagccgagaaagtggttgaa
ttagctgatgcatacggcttcgacgcaatagagctgggccagatcataggattcctgttt
gaagccatggataagggattacttagaccagaggagatagggctacccggtaagccattc
tttgacccggcatcatacagtatagagtatgcaagagttaacgcagagctagctgtaaag
ataattgaacaacttgccttcgggagcaatccattactccgcctcataggtgagagggga
ttgaggtcggctgccaagatactggatatattatatagggagaggataatagagaggaag
acaaggttcagcgatatacctatatacgctgcattcggcgaagaaggccatataacgcct
aactactactggacgcccggcctagtagccccactagtggttctaggcaagtactggacg
gtttatagtggcgtattcatggagccagaggagttcgcgtcaaaatccattgagagagcc
atatacgaagcattaatagctgatatggggctctgcaggttccataggggttgggctgag
aaagctataccagtgatactcgagaaatactatggtgttgaaaagccgcttgaaaagata
cgtgagctatataagaagatagcggaataccagaagctagctggggctctaccagtcttc
tgggattcagggaagataatagacttcatggctctcgcggctgaagaatatggtaatgta
gagtggggtggaaagttcaaggtaaataaggaggcagctgcaagagagtggtgggagcgc
ttctacaggaagcttgaggagttaaccaggtaa

DBGET integrated database retrieval system