KEGG   Desulfurococcus fermentans: Desfe_0691Help
Entry
Desfe_0691        CDS       T02136                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
dfd  Desulfurococcus fermentans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(657014..658114)
Genome map
AA seq 366 aa AA seqDB search
MEWRGQYIELIKKLTSLHAPSGREDPVKDLVAELMKPHVDKLWIDVWGNVVGYRKGSKGS
GKIMIAAHMDEIGLFISHIEDDGFLRVIPIGGVLERTLLYQRVIVRTRDGKLYRGVIGLK
PPHVIKPEEAQKVPELRELFIDVGASSKEEVEKMGIRVGDIAVFDREVAELGWNRITGKA
FDDRVGVVVMLKALEMLEKHDVDVYFVATVQEEVGLKGAKTSAYGISPDVALAIDVTIAS
DVPGVAKSEWFTRLGYGPAIKIVDGRNASGLIAHPKVVEFLVSIAEKKRIPYQLDVISGG
TTDASTIALNKEGVAAGTISIPSRYIHSPVEVVDLRDLYNASLLAKAFIEEATPEWIQSI
KGVVIK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttggaatggaggggccagtacatagagttaattaagaagctaaccagccttcatgctcct
agtggaagagaagacccagtgaaagacctcgttgccgagttgatgaagcctcatgtggat
aaactatggatagacgtatgggggaacgtagttggatataggaagggctctaagggctct
ggtaaaatcatgattgcagcccacatggatgaaataggcttattcatctctcacatcgag
gatgatgggtttctaagggttatacccataggtggagtactcgagaggactcttctctac
caaagagtaattgttaggacgagggatgggaaactatacaggggtgtgatagggttaaag
cctccccatgtaattaagccggaggaagcccagaaagtaccggagctacgggaactcttc
atagatgttggtgcatcatcaaaggaggaagtggagaagatgggtataagagtcggcgat
atagctgtatttgatagagaggtggctgagttaggctggaacaggataaccggtaaggcg
ttcgatgacagggttggcgtcgtggttatgttaaaggctcttgaaatgcttgagaaacac
gatgtagacgtctatttcgttgcaacagtccaggaggaagtagggttgaagggggctaag
acatcggcttacggtatctcacctgatgtggcattagcgatagatgtaaccatagcaagc
gatgtacctggagtagctaaaagcgagtggttcactcggctaggatatggtccagctata
aagatagttgatgggagaaatgcaagtgggttgatagcgcatccaaaggtggttgagttc
ctggtgagcattgccgagaaaaagaggataccttatcaattagacgtgatctcaggtggt
acaaccgatgcctcaacaatagctttaaacaaggagggtgttgctgctggaacgatctct
attccctcaaggtatatacatagccctgttgaagtagtggatttaagagacctctataat
gcatcactactagctaaggccttcatagaggaggcaacgcctgagtggattcaaagcata
aagggagtagtaataaaataa

DBGET integrated database retrieval system