KEGG   Desulfurococcus fermentans: Desfe_0691Help
Entry
Desfe_0691        CDS       T02136                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dfd  Desulfurococcus fermentans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desfe_0691
Enzymes [BR:dfd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Desfe_0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(657014..658114)
Genome map
AA seq 366 aa AA seqDB search
MEWRGQYIELIKKLTSLHAPSGREDPVKDLVAELMKPHVDKLWIDVWGNVVGYRKGSKGS
GKIMIAAHMDEIGLFISHIEDDGFLRVIPIGGVLERTLLYQRVIVRTRDGKLYRGVIGLK
PPHVIKPEEAQKVPELRELFIDVGASSKEEVEKMGIRVGDIAVFDREVAELGWNRITGKA
FDDRVGVVVMLKALEMLEKHDVDVYFVATVQEEVGLKGAKTSAYGISPDVALAIDVTIAS
DVPGVAKSEWFTRLGYGPAIKIVDGRNASGLIAHPKVVEFLVSIAEKKRIPYQLDVISGG
TTDASTIALNKEGVAAGTISIPSRYIHSPVEVVDLRDLYNASLLAKAFIEEATPEWIQSI
KGVVIK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttggaatggaggggccagtacatagagttaattaagaagctaaccagccttcatgctcct
agtggaagagaagacccagtgaaagacctcgttgccgagttgatgaagcctcatgtggat
aaactatggatagacgtatgggggaacgtagttggatataggaagggctctaagggctct
ggtaaaatcatgattgcagcccacatggatgaaataggcttattcatctctcacatcgag
gatgatgggtttctaagggttatacccataggtggagtactcgagaggactcttctctac
caaagagtaattgttaggacgagggatgggaaactatacaggggtgtgatagggttaaag
cctccccatgtaattaagccggaggaagcccagaaagtaccggagctacgggaactcttc
atagatgttggtgcatcatcaaaggaggaagtggagaagatgggtataagagtcggcgat
atagctgtatttgatagagaggtggctgagttaggctggaacaggataaccggtaaggcg
ttcgatgacagggttggcgtcgtggttatgttaaaggctcttgaaatgcttgagaaacac
gatgtagacgtctatttcgttgcaacagtccaggaggaagtagggttgaagggggctaag
acatcggcttacggtatctcacctgatgtggcattagcgatagatgtaaccatagcaagc
gatgtacctggagtagctaaaagcgagtggttcactcggctaggatatggtccagctata
aagatagttgatgggagaaatgcaagtgggttgatagcgcatccaaaggtggttgagttc
ctggtgagcattgccgagaaaaagaggataccttatcaattagacgtgatctcaggtggt
acaaccgatgcctcaacaatagctttaaacaaggagggtgttgctgctggaacgatctct
attccctcaaggtatatacatagccctgttgaagtagtggatttaagagacctctataat
gcatcactactagctaaggccttcatagaggaggcaacgcctgagtggattcaaagcata
aagggagtagtaataaaataa

DBGET integrated database retrieval system