KEGG   Desulfurococcus fermentans: Desfe_0716Help
Entry
Desfe_0716        CDS       T02136                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dfd  Desulfurococcus fermentans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desfe_0716
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desfe_0716
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desfe_0716
Enzymes [BR:dfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desfe_0716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(686963..688216)
Genome map
AA seq 417 aa AA seqDB search
MKCSRCGRRLLLSEKPLTCPSKDLGRLDIVYDYEAIAESINRDVLSQRSFNMWRYMEFLP
VPSRDYIVSLGEGGTPLLKARRLGEKLGLRNLYLKDETRNPTGSFKDRAMSVSVSMAVYF
GFKKAVIASSGNAAASLAAYGAKAGIEVYAFVPDFAGYGKIAQLLYYGAKVFKVRWSEAE
DPTVKMMRILYEEHGFYPSPSFGVFNPYQVEGPKTISMEIVEQLKWMVPDQVFVPTGAAS
LLTGVFNGFRDFNMVGWINRYPKLVAVQPEGNHPFVRAWRERADPMNIRPWEKPPDTIAT
GLEDTYPWDGDAGLKALYTTNGYGVVVSDKEILDSMKMLASLEGVFAEPSGAAGLAGLIK
AIEEKQVDRDEVIVVLVTGHGLKDPDIIRKTAGEPPLINPSVEEFRKVAREFYGVLA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtgtagtaggtgtggcagaagactacttctaagcgagaaaccattgacatgcccc
agcaaggatctgggtaggctagatatagtgtatgactatgaagcgatagctgagagcatt
aatagagatgttctctcacaaagatcattcaacatgtggagatacatggaattcctccca
gtgccaagcagagactatatcgtctcacttggtgaaggaggtacccccctactaaaggcg
aggagacttggagagaagttgggcctgagaaacctgtatcttaaggatgaaacaaggaat
ccaactgggagctttaaggatagagcaatgagcgtgtctgtgtccatggccgtatacttc
ggcttcaagaaggcagtgatcgccagcagtggtaatgcagccgcatctctagcagcctac
ggggctaaagccggtatagaggtctatgcatttgtccctgatttcgctggctatggtaaa
atagcccagttactctactatggagccaaagtatttaaggttagatggagtgaagcagag
gatcccacggttaaaatgatgcgtatcctctacgaggaacacggcttctacccaagtcca
agcttcggtgtcttcaacccataccaggtggagggacctaagaccatctctatggaaata
gtagagcaactgaaatggatggtgccggatcaagttttcgtaccaaccggtgcagccagc
ctattaaccggggtcttcaacgggttcagggacttcaatatggttggatggataaaccgg
tatcctaagctagtagctgtacaacccgaggggaatcacccctttgtaagggcttggaga
gaaagggctgatccgatgaatatacgtccctgggagaagccgccggatacaatagctacc
gggctagaagacacttatccatgggatggtgatgctggattgaaggccttatacaccacc
aatggttacggtgtagttgtaagcgataaggaaatactggattcaatgaagatgctggct
agtcttgaaggcgtatttgctgagccaagtggtgcagccggtttagccggcctaataaag
gctattgaggagaaacaggtggatagggatgaagtaatcgtggtactggtcacaggacat
ggcctaaaggatcctgatataattaggaaaacagctggggaacccccattaataaaccca
agtgttgaggaattcaggaaggttgcccgcgaattctatggtgttttagcctag

DBGET integrated database retrieval system