KEGG   Desulfurococcus amylolyticus DSM 16532: Desfe_0731Help
Entry
Desfe_0731        CDS       T02136                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dfd  Desulfurococcus amylolyticus DSM 16532
Pathway
dfd00300  Lysine biosynthesis
dfd01100  Metabolic pathways
dfd01120  Microbial metabolism in diverse environments
dfd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Desfe_0731
Enzymes [BR:dfd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Desfe_0731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFL66630
UniProt: I3XRQ6
Position
705196..706428
Genome map
AA seq 410 aa AA seqDB search
MTISQIYEIAKKILVDSIKFPTVLGEAYEDMIDYYREQLSEYGIHVTIHRVPDEFLRKTL
PREFNPEKPRFILLARIGNGEKVLQFNGHYDVVSPGEGWEMPPFEPVVRDDLVYGRGATD
MKGGIASILTALISLVQERREPSVIIEVALVPDEEIGGRTGTGYLVNELGSRPDYVIIAE
PSGLDNMYIGHRGNVWGIIRVHGKQAHGSAPWLGDNAFEKMLVFAQEFLKRYRERVSSRK
SNYLYEDERAAYPTITPGGLLIAPGSINIVPGTAGFSIDRRLIVEERVEDVIGEIQELLG
QVSRELNIDSSFTLVESSPPAFTPPDNKYTQILGEIIRKNTGREPRKTICIGGLDLRYYT
IKGIPAVSYGPGEVGLAHKPNEHIRISDVVRVSKIYVDFAKRFEKIQVDT
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
ttgactatttctcaaatatatgagatagctaaaaagatacttgttgatagtatcaagttc
cccactgtgcttggagaagcctatgaggatatgattgactattaccgggagcagttatcg
gaatatggtatccatgtgacaatacacagggttcccgatgaattccttaggaagaccctt
cccagggagttcaaccctgagaaacccaggttcatattgctggctagaataggtaacggt
gaaaaggtacttcaattcaatggacactatgatgtagtgtcaccgggagagggctgggag
atgccgcccttcgagcccgttgtcagggatgatctagtatatgggcgtggtgcaacggat
atgaagggtgggatagcgtctatacttacagccctcatatctcttgtacaggagaggagg
gagccaagtgtaattatcgaggttgctcttgtaccggatgaagagatagggggtaggact
ggcacgggctacctggttaatgagcttggtagtaggcctgactatgttattatagctgaa
ccctccggcttagataacatgtatattggtcatagaggaaatgtatggggtatcataagg
gtgcatggtaagcaggctcacggctcagcaccgtggcttggagacaacgcgtttgagaag
atgcttgtgtttgcgcaggaattccttaagaggtatagggagcgggtttcctccaggaag
agtaactacctatacgaggatgaaagagcagcctatcccacgattacaccgggtggactc
ttgatcgcacctggatcgataaatatagtgcctggaacagcgggtttcagcatagatagg
aggttgatagttgaggagagggttgaggatgtgatcggagaaatccaggaattacttggt
caggtcagcagagagctcaatatagattcatcattcacacttgtagagtcctcgccgcca
gcgtttaccccacctgataacaagtatactcaaatactcggtgagatcataaggaagaat
actggtagagaacctaggaaaaccatatgtatcggtgggctggatctgagatactataca
attaaaggaataccagccgtatcatacggaccaggtgaggtggggctagctcataaaccc
aatgaacatattaggataagcgatgtagtaagggttagcaagatatatgtcgactttgct
aagagatttgagaaaatccaggttgatacctag

DBGET integrated database retrieval system