KEGG   Desulfurococcus amylolyticus DSM 16532: Desfe_0761Help
Entry
Desfe_0761        CDS       T02136                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dfd  Desulfurococcus amylolyticus DSM 16532
Pathway
dfd00260  Glycine, serine and threonine metabolism
dfd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dfd01100  Metabolic pathways
dfd01110  Biosynthesis of secondary metabolites
dfd01130  Biosynthesis of antibiotics
dfd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desfe_0761
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desfe_0761
Enzymes [BR:dfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desfe_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP FtsA
Motif
Other DBs
NCBI-ProteinID: AFL66658
UniProt: I3XRT4
Position
complement(735934..737220)
Genome map
AA seq 428 aa AA seqDB search
MELRSTQTPDILPSYWYNIVPDLPEPLPPMIHPSGEPVKRSELEVLFPRSLVEQELSTQS
RIPIPEAVRETLLMLGRPTPLIRARRLEEALKTNARIFFKYEGVLPTGSHKINTAVAQAY
YNAVESVERVSTETGAGQWGSALSLAGNIYGLKVRVFMVRASYLQKPYRRILMEAYGAEV
YPSPSTKTNTGRKLLAGNPDHPGSLGIAISEAIEDVVSSEGRAKYSLGSVLNHVLLHQSV
IGLETIKQLELLGVERVDYVIGCVGGGSNFAGLSYPFIGYNYNNGEPPVFIAVEPETVPS
MTRGEYRYDYGDTAGLTPLLKMYTLGHDYIPPPIYAGGLRYHGVAPSLSILVKNNIVKPV
AYPQDEVLKAGLVFARTQGILPAPESSHAVKAVIDVALKYRGASEKPVILFNLSGHGLLD
LSAYTRNY
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaattaagaagtacccaaacacctgatatactcccatcctactggtataatatagta
cccgatctacccgaaccactaccccccatgattcatcctagcggggagccagttaagaga
agcgagctagaagtattgttccccaggagtctcgtggagcaggagctcagtacacagagc
cgaatacctatccccgaggccgtcagagagacactactcatgctgggacggcccacgcca
ttgataagggcgaggaggctggaagaagctttgaagactaatgcaagaatattctttaaa
tacgagggcgtactccccacgggatcccataaaatcaacacagccgttgcgcaggcatac
tataatgcggttgaaagcgttgaaagagtgtccactgagaccggcgctggtcagtggggc
tcagctctctcattggctggcaacatatacgggttaaaggtaagagtattcatggtaagg
gctagttatcttcagaaaccttatagaaggatactgatggaggcctatggtgctgaagta
tatcctagtccaagcactaagaccaataccggtagaaagctcttagcagggaaccctgat
caccctggcagcctaggtatagctataagtgaagcaatagaagacgtggtgtcgagtgag
ggtagagcgaagtatagccttggaagcgtcttaaaccatgtactactgcatcaatctgtg
atagggttagaaaccattaagcaattagagttactaggggttgagagagtagactatgtt
attggatgcgttggaggaggctccaacttcgctgggctctcatacccattcataggctac
aactataataatggcgagccaccggtgttcatcgctgttgaaccagaaacagttccctct
atgaccaggggtgagtatagatatgactacggcgatacagccggattaacaccattatta
aaaatgtataccctgggccatgactacatcccaccgccaatatatgcaggtggattaaga
taccatggcgttgctccctcgctaagcatactcgttaaaaacaatattgtaaaaccagtt
gcataccctcaggacgaggtattgaaggctggactcgtattcgccagaacccagggtata
cttccggcccctgaaagctctcatgcagtgaaagcagtgatagatgtagcgttgaaatac
aggggtgccagcgagaaaccagtgatattattcaatctaagcggtcacgggctactggat
ctctcagcgtacacgaggaattattag

DBGET integrated database retrieval system