KEGG   Desulfurococcus fermentans: Desfe_0761Help
Entry
Desfe_0761        CDS       T02136                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dfd  Desulfurococcus fermentans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desfe_0761
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desfe_0761
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desfe_0761
Enzymes [BR:dfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desfe_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(735934..737220)
Genome map
AA seq 428 aa AA seqDB search
MELRSTQTPDILPSYWYNIVPDLPEPLPPMIHPSGEPVKRSELEVLFPRSLVEQELSTQS
RIPIPEAVRETLLMLGRPTPLIRARRLEEALKTNARIFFKYEGVLPTGSHKINTAVAQAY
YNAVESVERVSTETGAGQWGSALSLAGNIYGLKVRVFMVRASYLQKPYRRILMEAYGAEV
YPSPSTKTNTGRKLLAGNPDHPGSLGIAISEAIEDVVSSEGRAKYSLGSVLNHVLLHQSV
IGLETIKQLELLGVERVDYVIGCVGGGSNFAGLSYPFIGYNYNNGEPPVFIAVEPETVPS
MTRGEYRYDYGDTAGLTPLLKMYTLGHDYIPPPIYAGGLRYHGVAPSLSILVKNNIVKPV
AYPQDEVLKAGLVFARTQGILPAPESSHAVKAVIDVALKYRGASEKPVILFNLSGHGLLD
LSAYTRNY
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaattaagaagtacccaaacacctgatatactcccatcctactggtataatatagta
cccgatctacccgaaccactaccccccatgattcatcctagcggggagccagttaagaga
agcgagctagaagtattgttccccaggagtctcgtggagcaggagctcagtacacagagc
cgaatacctatccccgaggccgtcagagagacactactcatgctgggacggcccacgcca
ttgataagggcgaggaggctggaagaagctttgaagactaatgcaagaatattctttaaa
tacgagggcgtactccccacgggatcccataaaatcaacacagccgttgcgcaggcatac
tataatgcggttgaaagcgttgaaagagtgtccactgagaccggcgctggtcagtggggc
tcagctctctcattggctggcaacatatacgggttaaaggtaagagtattcatggtaagg
gctagttatcttcagaaaccttatagaaggatactgatggaggcctatggtgctgaagta
tatcctagtccaagcactaagaccaataccggtagaaagctcttagcagggaaccctgat
caccctggcagcctaggtatagctataagtgaagcaatagaagacgtggtgtcgagtgag
ggtagagcgaagtatagccttggaagcgtcttaaaccatgtactactgcatcaatctgtg
atagggttagaaaccattaagcaattagagttactaggggttgagagagtagactatgtt
attggatgcgttggaggaggctccaacttcgctgggctctcatacccattcataggctac
aactataataatggcgagccaccggtgttcatcgctgttgaaccagaaacagttccctct
atgaccaggggtgagtatagatatgactacggcgatacagccggattaacaccattatta
aaaatgtataccctgggccatgactacatcccaccgccaatatatgcaggtggattaaga
taccatggcgttgctccctcgctaagcatactcgttaaaaacaatattgtaaaaccagtt
gcataccctcaggacgaggtattgaaggctggactcgtattcgccagaacccagggtata
cttccggcccctgaaagctctcatgcagtgaaagcagtgatagatgtagcgttgaaatac
aggggtgccagcgagaaaccagtgatattattcaatctaagcggtcacgggctactggat
ctctcagcgtacacgaggaattattag

DBGET integrated database retrieval system