KEGG   Desulfurococcus fermentans: Desfe_0909Help
Entry
Desfe_0909        CDS       T02136                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dfd  Desulfurococcus fermentans
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Desfe_0909
Enzymes [BR:dfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Desfe_0909
Exosome [BR:dfd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desfe_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
879204..880778
Genome map
AA seq 524 aa AA seqDB search
MSDGYILSIDQGTTGTRAILFNHEGLPVKMAYREHRQIYPRPGWVEHDPLEIWVNTRYVI
KQVLEGSGVNPGEIKAIGVTNQRETILLWDPETGNPVYNAIVWQDRRTAREVEYLKSKYI
DLICSKTGLIPDSYFSSTKIWWILDHVPGVREKAVSGRVIAGTIDTWIIWNLTRNSRDVL
TPEKKGAHVTDYSNASRTMLFDIQRIDWDRELLEVQGRIPLEILPLPRPSSDKSLYGYVG
PEIADELFHGYRVPIAGAVGDQQAALFGQAGFEQGDIKCTYGTGNFILVNTGATPVFSKH
GLITTIYYSIEPGKAVYALEGSIFVTGAAIQWLRDGLKIIEVSAEVNPLAESVSDTGGVY
FVPAFTGLGAPYWDQYARGLIIGITRGTERKHLARAVLESIAYLTRDVVEIVKLETGSEI
KVLKADGGASRSDFLMQFQADILNTKVVRPMVYETTSLGAAYLAGLAVDYWRSIDELRRY
WRAEKEFIPRISEEVRERLYKGWKEAVKRALGWAREVPWAYGYE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgatggctatattttatccatagatcaaggcactacaggcactagggcaatcctt
ttcaatcatgaaggtctacctgttaaaatggcttacagagaacatagacaaatatatccg
aggcctggctgggtcgagcatgatcccttggagatatgggttaacacgaggtatgttatc
aagcaggttctcgagggtagcggtgttaatccaggtgagattaaggctataggggtcacg
aatcaacgggagaccatactcctctgggatcccgagacgggcaatcctgtctacaatgct
attgtgtggcaggataggaggacggctagggaggttgaatacttaaagagtaagtacata
gatctcatatgctctaagaccgggctcatacccgacagctacttctctagcactaagata
tggtggatcctagaccacgtgcccggtgtaagggagaaggcggtaagcggccgggttata
gccggcaccattgatacgtggattatatggaatctgacaaggaattcaagagatgtgtta
acaccagagaagaagggggctcatgtaaccgattactcgaacgcttctagaaccatgctc
ttcgacatacagaggatcgattgggatagggagctacttgaggtacagggtaggataccc
ttggaaatactcccgcttccacgcccctcaagcgataaaagtctttacggctatgtgggt
ccagagatcgctgatgaattattccatggatacagggtacctatagctggagctgtgggt
gatcaacaggctgcattatttggtcaagctggattcgagcaaggcgatataaagtgtacc
tatggcaccgggaacttcatactggttaacaccggggctacaccagttttctctaagcat
ggattgatcacaacgatctactatagtattgaaccgggtaaagcagtatacgccctagag
ggaagcatatttgtaaccggggcggcaatacagtggctacgcgacgggttaaagataata
gaggtctcagccgaggtcaacccgcttgcagaatcagtgagcgatacaggtggagtatac
tttgtcccagcgttcaccggcctaggtgcaccctactgggatcaatacgctaggggcctc
ataataggtataacaagaggcaccgagaggaagcacctggcaagagcggtactggaatcc
atagcctacttaaccagggacgttgttgaaatagtgaagcttgaaacaggttcggagata
aaggtcttaaaggctgatggtggtgcatctagaagcgacttcctgatgcagttccaagct
gatatattgaatacaaaagtagttaggccaatggtgtatgagactacatcgcttggtgca
gcatatctagcagggctagccgtcgactactggagaagcattgatgaactacgtagatac
tggagggccgagaaagagttcatcccgagaatcagtgaggaggtaagggaaaggctctac
aaggggtggaaggaggctgttaagagggcgttaggatgggcccgtgaagtaccatgggcc
tatggatatgagtaa

DBGET integrated database retrieval system