KEGG   Desulfurococcus fermentans: Desfe_0968Help
Entry
Desfe_0968        CDS       T02136                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dfd  Desulfurococcus fermentans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desfe_0968
Enzymes [BR:dfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Desfe_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(937527..938453)
Genome map
AA seq 308 aa AA seqDB search
MSTPIHVSIGNFNIDIAVYIDKAPGIDESVNARDIDIRPGGAASNYAVAVSHYGHRAVLV
ASVADHLLVKTHLESIRRLGVDISHVTYLNASPGIVISVIYPDGSRSMIRSLGANAYLSP
DKISQEILDSASVVHMATLHPERAAGIVERVHGAVMSYDPGIYVNTQRETLETVLKHVDI
LFLNSSEFNELTSKIKPGELFKLGVEVLVIKLGSKGAAAVLGDGSIYHAYVKPLGNPIDT
TGAGDAFNAFFNASYIDTRNVMTALRHGVAAGALKTLCKGSILCWNRDLFIKHLELSTIS
KETGMPGF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccccgatacatgtaagcataggtaattttaacatagacatagccgtatatatc
gataaagcgccaggaatagatgaaagcgtgaacgcgagggacatcgatataaggcctggt
ggggcagcctcgaattatgccgtagctgtatcgcactatggacacagggctgtgcttgta
gcatcggttgcggatcacctactggtgaaaacccacctggaatcaataaggagactaggc
gttgacatatcgcatgtaacgtaccttaatgcatcaccagggattgttatatcagtgatc
tacccggatggctcgaggtctatgattaggagcctcggtgctaacgcgtatctatcaccg
gataagataagccaggaaatacttgattcagccagtgtagttcacatggctactttacac
cctgagagagcagccggaatcgtagaaagggttcatggggcagtgatgagctatgatcca
ggaatctacgtgaatacccagcgagaaacattggaaacagtgttgaagcacgtggacata
ctcttcctgaatagtagtgaattcaacgagttaactagtaaaataaagccaggtgaacta
tttaaactaggggtagaggtcttagtgattaaactaggcagtaagggggcggctgctgta
ctaggagatggcagtatatatcacgcatatgtaaaacccctgggtaacccgattgataca
acgggagctggcgacgcattcaatgcattcttcaacgcgtcgtatattgatacaaggaac
gtgatgacagctcttagacatggagtggctgcaggagcattaaagactctctgcaaggga
agcattctatgctggaatagagatctatttattaagcacctagagctaagtactattagt
aaggagactggaatgcctggattctag

DBGET integrated database retrieval system