KEGG   Desulfurococcus amylolyticus DSM 16532: Desfe_1077Help
Entry
Desfe_1077        CDS       T02136                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dfd  Desulfurococcus amylolyticus DSM 16532
Pathway
dfd00300  Lysine biosynthesis
dfd01100  Metabolic pathways
dfd01120  Microbial metabolism in diverse environments
dfd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Desfe_1077
Enzymes [BR:dfd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Desfe_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFL66949
UniProt: I3XSM5
Position
complement(1026094..1027356)
Genome map
AA seq 420 aa AA seqDB search
MVIGLLDRVIARIDSMRDEMARTLSELISIPAIGPDNGGEGEYDKAARLLDIIKDWGFTK
IERYDAPDPRVKHGVRPNILAYYEGSDPNASRLWILSHLDVVPPGDLSKWTVTKPFEPVI
RDGKVYGRGSEDNGQAIVSSLYAVKALMELGVKPRRTVVLAFVSDEETGSKYGLGYLVEK
HRELFRDNDLVLVPDAGVPDGSFIEIAEKSILWVKIKITGAQTHASTPHRGINAHAVASR
ITSNLYRYLYKKYSERDELFDPPLSTFEPTMTFNPSNAPNIIPGEYSVVFDCRILPKYSI
DDVLRDMKNTCKNTIRRFKGLAGGKPGFNIEVLQRLDAPAPTPKDSEIVRLLERALREVR
GIQPRVGGIGGGTVAALFRKIGLPAAVWSTIDEMAHQPNEYAKIDNLVNDAKVMAALMMY
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggtgatagggttgcttgatagggtgatcgctagaatagattccatgcgggatgaaatg
gctaggactctctccgagttgatcagtataccggccattgggcctgacaatggtggtgaa
ggcgagtacgataaagctgctagattgcttgatataatcaaggactggggctttacaaag
atagagaggtatgacgctcctgatccccgtgttaaacacggtgtaagacccaatattcta
gcatactatgagggcagcgaccctaatgcgtctaggctctggatactgagtcatctcgac
gttgttcctccaggcgatttatccaagtggactgttacaaagccgtttgaacccgttatc
agagacggcaaggtttatggtagaggcagtgaggataatggacaggcaattgtttcatcc
ctttacgctgtaaaagccctcatggagctaggcgtaaaacctagaagaacagtggtatta
gccttcgtcagcgatgaggagactggaagcaagtatggcctgggatacctagtggaaaag
catagggagttgttcagggacaacgatctcgtcctggtacccgatgcaggtgtacccgat
ggctccttcatagagatagcagagaagagcatcctatgggttaaaataaagattactggt
gcacagacacatgctagtaccccgcacaggggtattaatgcccatgctgttgcatcgagg
atcacaagcaacctgtacagatacctatataaaaaatactcggagagagatgagctcttt
gatccaccactcagcacttttgagccgactatgacgttcaacccaagtaacgcgccaaac
attataccgggagaatatagtgttgtatttgactgcaggatactccctaagtacagtata
gatgatgtattaagagacatgaaaaatacttgtaaaaacacgatacgcagattcaagggt
ttagctggtggaaaaccaggtttcaatatagaggtgctccaaaggcttgatgccccagct
cccacgccaaaggatagcgagatagtgaggttgcttgaaagagctttaagggaggtaagg
gggattcagccacgtgtaggaggtattggtggaggaacagttgcagcgctctttaggaaa
atcgggttacctgcggctgtgtggagcactattgatgaaatggctcatcagccaaacgag
tatgctaaaatagataacctagttaatgatgccaaggtaatggctgctctgatgatgtat
taa

DBGET integrated database retrieval system