KEGG   Desulfurococcus amylolyticus DSM 16532: Desfe_1093Help
Entry
Desfe_1093        CDS       T02136                                 

Definition
(GenBank) tungsten-dependent formaldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dfd  Desulfurococcus amylolyticus DSM 16532
Pathway
dfd00030  Pentose phosphate pathway
dfd01100  Metabolic pathways
dfd01120  Microbial metabolism in diverse environments
dfd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desfe_1093
Enzymes [BR:dfd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Desfe_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AFL66965
UniProt: I3XSP1
Position
1041592..1043418
Genome map
AA seq 608 aa AA seqDB search
MHGWWGKALLIDLTKSKVKEVSIEPEILHGFIGGRGLAVRLLWDLIPPGVDPLSPYNALI
VASGPLSGLPLPSSGKLVVASKSPLTNGYGDGNIGSMASHHLRHSGYDALIITGASKKPV
YLYIENGKVEFRSAEDLWGLDTFTTEEKLVREHGRNIGILEIGPAGEHMVRYATVISQKG
RSGGRPGMGAVMGSKKLKAIVIKGNMEPPIADKEALRKISEEAYKKIQGSDNYDYWIRQG
TMSTIQWSHQNSVLPTMNFREGVWELYETISGDLMEKLKIDRRGCPYCNMQCGNVVGDDV
GEESELDYENVAMLGSNILLENLKRVAEINKLADKLGIDTISLGNSIGFYMEASERGLVK
ERVEWGDFKAVREITIDTAYRRGLGAFIAEGVMRMARSIGGEALDFAMHVKGLEVSAYNC
HTTPGMALAYGTSSIGAHHKDAWIISYEVRTDRSSYSRDKVERLIFLQNMRGGMFESLTT
CRLPWVEVGLDLEYYPRFLSAVTGLKWSLDDISVTANRIYTLIRAFWIREYMGWSSSMDY
PPTRWFKHPLTKGPYAGSHLDISKYSEMLKIYYETRGWDENGVPKKETLIKLGLDFTIPV
LEDFVKLQ
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgcatggctggtggggtaaagcactactaatagatttaaccaaaagtaaggtaaaagag
gtaagcatagagccagagatactacatggattcatcggtggaagaggcctagcggttaga
ctcctatgggatctaatccctcccggagtggatccgttatcaccatataatgcattaata
gtggcctccggtcctctctcagggctaccattacctagtagcggtaaactagttgtagca
tctaagagcccgctgacaaatggctatggggatggcaatataggatccatggccagccac
cacttaaggcacagcggctacgatgcactcataataacaggggcatctaagaaacccgtc
tacctctacattgaaaacggtaaagtagagttcaggagtgccgaggatctatggggactt
gacaccttcactactgaggaaaaactggttagagaacatggtagaaacattggcatactt
gaaatcggaccggcgggagagcacatggttagatacgccacagtgatctcccagaagggg
agaagcgggggacgcccaggcatgggtgctgtaatgggcagtaaaaagctgaaggcaata
gtgatcaagggaaacatggagccacctatagccgataaggaggctcttagaaaaatatct
gaggaagcctataagaagatacagggtagcgataactatgattactggattagacaaggc
acaatgtccacaatacagtggagtcatcaaaacagcgtcctacctacaatgaactttagg
gagggtgtgtgggagctatatgaaaccataagcggtgatttaatggaaaaactgaagata
gatagaaggggatgtccttactgtaacatgcagtgcggtaatgttgttggcgatgacgta
ggggaggagagcgaactagactatgagaacgtagcgatgctgggcagtaatatattatta
gagaacttgaaaagggttgccgagataaataagctagctgataaactggggatagatacc
ataagtctgggcaactcgatagggttctatatggaagctagcgagagagggctagtcaaa
gagagggttgaatggggagacttcaaagccgtgagagagataaccattgatacggcatat
agacgcgggttaggagcattcatagctgagggagttatgaggatggcgaggagtattggc
ggtgaggcacttgatttcgccatgcatgtgaagggtttagaggtatctgcatacaactgt
cacacaacccccggaatggccctagcatatggcacatcttccatcggggcccatcacaag
gatgcctggataataagctacgaagttagaacggatagatcatcgtatagcagggataag
gttgaacgcttaatcttcctgcaaaacatgcgtggaggaatgtttgagtcgctgacaaca
tgtaggcttccatgggttgaagtaggcctcgacctcgagtactacccaagattcctttca
gctgtaactggtttaaaatggagtctcgacgatataagcgttactgccaacaggatctac
acgttgataagggcattctggatacgcgaatacatgggttggagtagctcgatggactac
ccgcccaccagatggtttaaacacccacttacaaaaggaccgtatgcgggttcacaccta
gatatctctaaatacagtgaaatgttaaagatatactatgaaacacgtggctgggatgaa
aacggtgtcccaaagaaggagactctcataaagctgggactagacttcacaatacctgtt
ctagaggactttgtgaagctacagtag

DBGET integrated database retrieval system