KEGG   Desulfurococcus fermentans: Desfe_1156Help
Entry
Desfe_1156        CDS       T02136                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dfd  Desulfurococcus fermentans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desfe_1156
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desfe_1156
   00640 Propanoate metabolism
    Desfe_1156
   00660 C5-Branched dibasic acid metabolism
    Desfe_1156
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desfe_1156
Enzymes [BR:dfd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desfe_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1107144..1108295)
Genome map
AA seq 383 aa AA seqDB search
MGSCMKLYEYEGKEIARKYGIETPRGILATSVEDVAKAYRELNTGTVVLKSQVLVGGRGL
AGGVKKASNLEEALAKARELFSMSIKGERVEKILVEEAVCISRELYMSLTVDRATRKLVY
LASGMGGVEIEELARKHPDKILRIPVDPFIGYSGYMARQALGFLGLQWDKLGQLDSIMRA
MYKIMMDYDAELVEFNPLAYTCDGRLTALDAKIIIDDNSLYRHPDLQPLYGRDATPYEKV
AKQLDFNYVELDGDIGVISNGAGLTMATMDSILHYGGRPANFLDIGGGATRERVREAVKI
VLTHPRVKAVLVNIFGGITRCDEVASGIVEALSEIKVVKPIVVRMLGTNEEEGRRILIEH
GITVYTEMDEAVLRIIQLVRGVG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggggtcctgtatgaaactgtatgagtatgaaggtaaggagattgctaggaagtatggt
attgagacccctagaggcatccttgcaaccagtgttgaggatgtggctaaggcatataga
gagttgaacacggggacagtagtattaaaatcccaggtactcgtgggcggtagaggcctg
gccggtggagtaaagaaggctagtaacctggaggaggcccttgcgaaggcaagggagctc
ttctcgatgagcattaagggtgagagggttgaaaaaatactggtggaggaggctgtgtgt
atcagtagggagctttacatgtctctcactgttgatagggctactagaaaactagtctac
cttgcctcaggtatgggtggtgttgaaatagaggagctagctagaaaacatcctgataaa
atactcaggatacccgtagacccgttcataggatatagtggctacatggctagacaggca
cttgggttccttggtcttcaatgggataaactaggacagctcgacagcatcatgagggcc
atgtataaaataatgatggactatgacgcggaactagtggagttcaatcccttagcctac
acgtgtgatgggaggcttactgcgctggatgcaaagataatcatagatgataacagctta
tacaggcatcctgaccttcagcctttatacgggagggatgccaccccctatgagaaagta
gctaagcaactcgacttcaattatgtcgagctcgatggagacataggtgtgataagtaat
ggagccgggttaacgatggccaccatggactcaattctacattatggtgggagaccagcc
aacttcctcgatattggtgggggtgctacacgtgagagggtcagggaggcagttaaaata
gtgctcactcatccgagggtcaaggcagtgttagtcaatatatttggcggtataaccagg
tgcgatgaagtggcttctggaatcgttgaagccctaagtgaaatcaaggtggttaaaccc
atcgtggttagaatgcttggcaccaatgaggaggagggtaggaggatacttattgagcat
ggtataactgtttacacggagatggatgaagcagtattaaggattatccaattagtcagg
ggggtgggctga

DBGET integrated database retrieval system