KEGG   Desulfurococcus fermentans: Desfe_1156Help
Entry
Desfe_1156        CDS       T02136                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dfd  Desulfurococcus fermentans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Desfe_1156
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Desfe_1156
   00640 Propanoate metabolism
    Desfe_1156
   00660 C5-Branched dibasic acid metabolism
    Desfe_1156
Enzymes [BR:dfd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Desfe_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1107144..1108295)
Genome map
AA seq 383 aa AA seqDB search
MGSCMKLYEYEGKEIARKYGIETPRGILATSVEDVAKAYRELNTGTVVLKSQVLVGGRGL
AGGVKKASNLEEALAKARELFSMSIKGERVEKILVEEAVCISRELYMSLTVDRATRKLVY
LASGMGGVEIEELARKHPDKILRIPVDPFIGYSGYMARQALGFLGLQWDKLGQLDSIMRA
MYKIMMDYDAELVEFNPLAYTCDGRLTALDAKIIIDDNSLYRHPDLQPLYGRDATPYEKV
AKQLDFNYVELDGDIGVISNGAGLTMATMDSILHYGGRPANFLDIGGGATRERVREAVKI
VLTHPRVKAVLVNIFGGITRCDEVASGIVEALSEIKVVKPIVVRMLGTNEEEGRRILIEH
GITVYTEMDEAVLRIIQLVRGVG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggggtcctgtatgaaactgtatgagtatgaaggtaaggagattgctaggaagtatggt
attgagacccctagaggcatccttgcaaccagtgttgaggatgtggctaaggcatataga
gagttgaacacggggacagtagtattaaaatcccaggtactcgtgggcggtagaggcctg
gccggtggagtaaagaaggctagtaacctggaggaggcccttgcgaaggcaagggagctc
ttctcgatgagcattaagggtgagagggttgaaaaaatactggtggaggaggctgtgtgt
atcagtagggagctttacatgtctctcactgttgatagggctactagaaaactagtctac
cttgcctcaggtatgggtggtgttgaaatagaggagctagctagaaaacatcctgataaa
atactcaggatacccgtagacccgttcataggatatagtggctacatggctagacaggca
cttgggttccttggtcttcaatgggataaactaggacagctcgacagcatcatgagggcc
atgtataaaataatgatggactatgacgcggaactagtggagttcaatcccttagcctac
acgtgtgatgggaggcttactgcgctggatgcaaagataatcatagatgataacagctta
tacaggcatcctgaccttcagcctttatacgggagggatgccaccccctatgagaaagta
gctaagcaactcgacttcaattatgtcgagctcgatggagacataggtgtgataagtaat
ggagccgggttaacgatggccaccatggactcaattctacattatggtgggagaccagcc
aacttcctcgatattggtgggggtgctacacgtgagagggtcagggaggcagttaaaata
gtgctcactcatccgagggtcaaggcagtgttagtcaatatatttggcggtataaccagg
tgcgatgaagtggcttctggaatcgttgaagccctaagtgaaatcaaggtggttaaaccc
atcgtggttagaatgcttggcaccaatgaggaggagggtaggaggatacttattgagcat
ggtataactgtttacacggagatggatgaagcagtattaaggattatccaattagtcagg
ggggtgggctga

DBGET integrated database retrieval system