KEGG   Desulfurococcus fermentans: Desfe_1240Help
Entry
Desfe_1240        CDS       T02136                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dfd  Desulfurococcus fermentans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Desfe_1240
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desfe_1240
  Lipid metabolism
   00071 Fatty acid degradation
    Desfe_1240
  Amino acid metabolism
   00350 Tyrosine metabolism
    Desfe_1240
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Desfe_1240
   00626 Naphthalene degradation
    Desfe_1240
Enzymes [BR:dfd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Desfe_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1176526..1177530)
Genome map
AA seq 334 aa AA seqDB search
MRAMVLYSPAPVESRPLKYMDVEKPSPGRGEVLIRIFKCGVCRTDLHIVEGELKPVKLPL
IPGHQVIGVVEDVGEGIEGIRRGERVGVPWLYYACGECRYCRRGLENLCENALFTGYSVD
GGYAEYMVAKAGFIHRIPDGIDDTHAAPLMCAGAIGYRSLKLTGLLGKGDATLGLFGYGA
AAHLVLQVARKLGLRVYVFTSNRWKIEKALENGAEWAGSTSEEPPRRLDAAIVYAPVSSV
FIEALKKIDKGGRVVLAEIYMTPIEQLDYSLLWHEKEVKSVANVTRKDVGEFLEVASRHG
VKPEVKTYRLSEANEALIELKKGGHLGQLVLDVT
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgagggcgatggttctctattctccggcccctgtcgagtcaaggccgttgaaatacatg
gatgtcgagaaaccaagccccggtagaggcgaggtcttgataaggatcttcaaatgcggc
gtgtgtaggacggatctccacattgttgaaggcgagttgaaacctgtaaagctcccacta
atacccgggcaccaggtaatcggtgtagtggaagatgtaggtgaggggattgaaggaatt
aggaggggggagcgtgttggagttccatggctatactacgcttgtggtgaatgcaggtat
tgtagaagaggtctcgagaacctctgtgaaaacgctttattcacaggctacagtgtggac
ggtgggtacgctgagtacatggttgcaaaggcaggtttcatacataggatacctgatgga
atagatgacactcatgcagctccattaatgtgtgctggtgcaataggctatagatcccta
aagctaacggggctccttggtaagggtgatgcaaccctgggtttatttggctacggtgca
gccgcacaccttgttctacaggtggctaggaagcttggcttaagagtatacgtgttcacg
agtaataggtggaagatagagaaggctctcgagaacggtgccgaatgggctggctcaaca
agtgaggagcccccgcgtagactcgatgccgcaatagtgtatgcacctgtgtccagcgtc
ttcattgaggcattgaagaagatagataagggcgggagagtagtattggctgagatatat
atgactccaatcgagcagctggactacagcctcctatggcatgagaaagaagtcaaaagc
gttgcgaatgtaactaggaaggatgtgggagagttcctagaggtagccagtagacacggt
gtgaagcctgaagtgaaaacctataggcttagcgaggccaatgaggcattaatagagtta
aagaaggggggacacctagggcaactagtactggatgtaacttaa

DBGET integrated database retrieval system