KEGG   Desulfurococcus amylolyticus DSM 16532: Desfe_1297Help
Entry
Desfe_1297        CDS       T02136                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
dfd  Desulfurococcus amylolyticus DSM 16532
Pathway
dfd00010  Glycolysis / Gluconeogenesis
dfd00020  Citrate cycle (TCA cycle)
dfd00620  Pyruvate metabolism
dfd00640  Propanoate metabolism
dfd00650  Butanoate metabolism
dfd00680  Methane metabolism
dfd00720  Carbon fixation pathways in prokaryotes
dfd01100  Metabolic pathways
dfd01120  Microbial metabolism in diverse environments
dfd01130  Biosynthesis of antibiotics
dfd01200  Carbon metabolism
Module
dfd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desfe_1297
   00020 Citrate cycle (TCA cycle)
    Desfe_1297
   00620 Pyruvate metabolism
    Desfe_1297
   00640 Propanoate metabolism
    Desfe_1297
   00650 Butanoate metabolism
    Desfe_1297
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desfe_1297
   00680 Methane metabolism
    Desfe_1297
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desfe_1297
Enzymes [BR:dfd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desfe_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_10 Fer4_16 Fer4_9 Fer4_2 Fer4_4 Fer4_8 Fer4_17 Fer4_3 Fer4_15 Fer4_13 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AFL67165
UniProt: I3XT91
Position
1224178..1224459
Genome map
AA seq 93 aa AA seqDB search
MSIRVTPPKTGQLPLTRPGIGVAGKTGFWRTIKPIVDQSKCTRCYQCEIFCPVNVIRVEP
ETGVKIDYDYCKGCGVCADVCPVNAISMVEEVK
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgagtatacgtgtaacaccacctaaaaccgggcaactacctttaacaaggcctggcata
ggagtcgctggtaaaacagggttctggaggacaatcaagcctatagtagaccaatccaag
tgcacccggtgctaccagtgcgagatattctgcccagtgaacgttataagggttgaaccc
gaaaccggtgtaaaaatagactatgactactgcaagggatgcggggtatgcgccgacgta
tgccccgttaacgcgataagcatggttgaggaggtgaagtag

DBGET integrated database retrieval system