KEGG   Desulfurococcus fermentans: Desfe_1398Help
Entry
Desfe_1398        CDS       T02136                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dfd  Desulfurococcus fermentans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dfd01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dfd00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:dfd00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1322866..1323930)
Genome map
AA seq 354 aa AA seqDB search
MKWKCNHCGFEANAFSEYHWRCPRCGEPLDLVYDGKLEKTSSKNIWEKYGDTIPLKPEKT
RREGNTPLVAEKIDGMTLLFKLEYLNPGGSFKDRGSALAIYYAYKSGFKSVIEDTSGNTG
ISVALYSRLYGLKTKIYMPKTAPPGKKKVIKALGAEIIEAPTRGDAAEMVLKEALTGAYY
VAHTWNYFYIIGASTIAWEVLEEDVPDYVISPIGSGGLFLGLVKGFEKALEAGWITKMPR
FIGVQGYSTQPVYKAFKGVTQPGEDSSLADGIMVPNPPRLNEIVNALHKYQGDVILVGNT
EILRAWRELWELGFLVEPTSASIYAALEKIKNQLSGKKVLLVLTGSGLKTIPDI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggaagtgtaaccattgtggttttgaagctaacgcgtttagtgaataccattgg
agatgccctcgttgcggtgaacccctagatcttgtttacgatggtaagcttgagaaaacc
agctcgaagaatatctgggaaaaatatggcgatacaatacctttgaaaccagagaagaca
aggagggagggtaacacaccactagttgcggagaaaatcgatggaatgacacttctcttc
aagcttgaataccttaatccaggcggtagcttcaaggaccggggttcagcactagctata
tactatgcctataaatcaggcttcaagagtgttatcgaggataccagcggtaacacaggt
atctcggtagccctctactcaagactctacggtttaaagacaaagatatatatgcctaaa
acagccccaccaggtaaaaagaaagtcatcaaggcactcggtgcggaaataattgaggcc
cctacacggggcgatgcagctgaaatggttttaaaggaggcacttacgggagcatactac
gtagcacatacttggaactacttctatataataggggcatccacaatagcctgggaggtt
ctcgaagaggatgtacccgactacgttatatcgccaataggatcgggcggcttattcctt
ggattagtaaaaggattcgagaaagctcttgaagcaggctggataaccaagatgcctaga
ttcataggtgttcaaggctatagcacacaaccagtttataaagcatttaaaggagtcact
cagccaggagaggactcgagtctagcagatggaataatggttccaaacccacctagactg
aatgaaatagttaatgcgttgcataaataccagggagacgtcatcctggtcggcaatacc
gaaatactaagggcatggagggaactatgggagcttggattccttgtagaaccaacctct
gcatccatttatgctgcactagaaaagattaagaaccagctttcaggcaagaaagtacta
ctagtattaacaggctcagggctgaaaaccataccagatatctag

DBGET integrated database retrieval system