KEGG   Desulfurococcus amylolyticus DSM 16532: Desfe_1398Help
Entry
Desfe_1398        CDS       T02136                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dfd  Desulfurococcus amylolyticus DSM 16532
Pathway
dfd00260  Glycine, serine and threonine metabolism
dfd00750  Vitamin B6 metabolism
dfd01100  Metabolic pathways
dfd01110  Biosynthesis of secondary metabolites
dfd01120  Microbial metabolism in diverse environments
dfd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desfe_1398
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desfe_1398
Enzymes [BR:dfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desfe_1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HypA Zn_ribbon_SprT Mu-like_Com Zn-ribbon_8 zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: AFL67263
UniProt: I3XTI9
Position
complement(1322866..1323930)
Genome map
AA seq 354 aa AA seqDB search
MKWKCNHCGFEANAFSEYHWRCPRCGEPLDLVYDGKLEKTSSKNIWEKYGDTIPLKPEKT
RREGNTPLVAEKIDGMTLLFKLEYLNPGGSFKDRGSALAIYYAYKSGFKSVIEDTSGNTG
ISVALYSRLYGLKTKIYMPKTAPPGKKKVIKALGAEIIEAPTRGDAAEMVLKEALTGAYY
VAHTWNYFYIIGASTIAWEVLEEDVPDYVISPIGSGGLFLGLVKGFEKALEAGWITKMPR
FIGVQGYSTQPVYKAFKGVTQPGEDSSLADGIMVPNPPRLNEIVNALHKYQGDVILVGNT
EILRAWRELWELGFLVEPTSASIYAALEKIKNQLSGKKVLLVLTGSGLKTIPDI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggaagtgtaaccattgtggttttgaagctaacgcgtttagtgaataccattgg
agatgccctcgttgcggtgaacccctagatcttgtttacgatggtaagcttgagaaaacc
agctcgaagaatatctgggaaaaatatggcgatacaatacctttgaaaccagagaagaca
aggagggagggtaacacaccactagttgcggagaaaatcgatggaatgacacttctcttc
aagcttgaataccttaatccaggcggtagcttcaaggaccggggttcagcactagctata
tactatgcctataaatcaggcttcaagagtgttatcgaggataccagcggtaacacaggt
atctcggtagccctctactcaagactctacggtttaaagacaaagatatatatgcctaaa
acagccccaccaggtaaaaagaaagtcatcaaggcactcggtgcggaaataattgaggcc
cctacacggggcgatgcagctgaaatggttttaaaggaggcacttacgggagcatactac
gtagcacatacttggaactacttctatataataggggcatccacaatagcctgggaggtt
ctcgaagaggatgtacccgactacgttatatcgccaataggatcgggcggcttattcctt
ggattagtaaaaggattcgagaaagctcttgaagcaggctggataaccaagatgcctaga
ttcataggtgttcaaggctatagcacacaaccagtttataaagcatttaaaggagtcact
cagccaggagaggactcgagtctagcagatggaataatggttccaaacccacctagactg
aatgaaatagttaatgcgttgcataaataccagggagacgtcatcctggtcggcaatacc
gaaatactaagggcatggagggaactatgggagcttggattccttgtagaaccaacctct
gcatccatttatgctgcactagaaaagattaagaaccagctttcaggcaagaaagtacta
ctagtattaacaggctcagggctgaaaaccataccagatatctag

DBGET integrated database retrieval system