KEGG   Desulfurococcus fermentans: Desfe_1398Help
Entry
Desfe_1398        CDS       T02136                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dfd  Desulfurococcus fermentans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dfd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desfe_1398
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desfe_1398
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desfe_1398
Enzymes [BR:dfd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desfe_1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1322866..1323930)
Genome map
AA seq 354 aa AA seqDB search
MKWKCNHCGFEANAFSEYHWRCPRCGEPLDLVYDGKLEKTSSKNIWEKYGDTIPLKPEKT
RREGNTPLVAEKIDGMTLLFKLEYLNPGGSFKDRGSALAIYYAYKSGFKSVIEDTSGNTG
ISVALYSRLYGLKTKIYMPKTAPPGKKKVIKALGAEIIEAPTRGDAAEMVLKEALTGAYY
VAHTWNYFYIIGASTIAWEVLEEDVPDYVISPIGSGGLFLGLVKGFEKALEAGWITKMPR
FIGVQGYSTQPVYKAFKGVTQPGEDSSLADGIMVPNPPRLNEIVNALHKYQGDVILVGNT
EILRAWRELWELGFLVEPTSASIYAALEKIKNQLSGKKVLLVLTGSGLKTIPDI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggaagtgtaaccattgtggttttgaagctaacgcgtttagtgaataccattgg
agatgccctcgttgcggtgaacccctagatcttgtttacgatggtaagcttgagaaaacc
agctcgaagaatatctgggaaaaatatggcgatacaatacctttgaaaccagagaagaca
aggagggagggtaacacaccactagttgcggagaaaatcgatggaatgacacttctcttc
aagcttgaataccttaatccaggcggtagcttcaaggaccggggttcagcactagctata
tactatgcctataaatcaggcttcaagagtgttatcgaggataccagcggtaacacaggt
atctcggtagccctctactcaagactctacggtttaaagacaaagatatatatgcctaaa
acagccccaccaggtaaaaagaaagtcatcaaggcactcggtgcggaaataattgaggcc
cctacacggggcgatgcagctgaaatggttttaaaggaggcacttacgggagcatactac
gtagcacatacttggaactacttctatataataggggcatccacaatagcctgggaggtt
ctcgaagaggatgtacccgactacgttatatcgccaataggatcgggcggcttattcctt
ggattagtaaaaggattcgagaaagctcttgaagcaggctggataaccaagatgcctaga
ttcataggtgttcaaggctatagcacacaaccagtttataaagcatttaaaggagtcact
cagccaggagaggactcgagtctagcagatggaataatggttccaaacccacctagactg
aatgaaatagttaatgcgttgcataaataccagggagacgtcatcctggtcggcaatacc
gaaatactaagggcatggagggaactatgggagcttggattccttgtagaaccaacctct
gcatccatttatgctgcactagaaaagattaagaaccagctttcaggcaagaaagtacta
ctagtattaacaggctcagggctgaaaaccataccagatatctag

DBGET integrated database retrieval system