KEGG   Dyadobacter fermentans: Dfer_0098Help
Entry
Dfer_0098         CDS       T00970                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dfe  Dyadobacter fermentans
Brite
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Dfer_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
113620..114717
Genome map
AA seq 365 aa AA seqDB search
MDVVPGMVLAGLALAFAACQKEERPVEPVWTGPTAVTWKKPAHFPDPVYDLSTNPLTEEG
IELGKFLFYDGILSRTNQIGCGTCHQQEAAFTHHGHELSHGVDDLLGTRNSPSIQNLAWN
PVFFWDGGVHDLDKVPFNPIQNPVEMDETVKNVIAKLQATPLATAKKPVNYPEMFRKAFG
DDQITTERMMKALSQFMLTMVSAESRYDFFKQGDGSALNAQEQEGLVLFKAKCSSCHTGE
LFTDHSFRNNGLVPLRLDDKGRSETSGDPADKYKFKVPSLRNVGLTAPYMHDGRYHTLEE
VLDHYTSAVQQSPTLDPGLQRADRKPGIDMTDSEKKSIIAFLRTLSDEQFIRNSKLSDPG
VGTNF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcgtgccgggcatggtactggccggcctggcgctggcatttgcagcctgccaa
aaagaggagcggcctgtggagcctgtctggaccggtcccacggccgtgacctggaagaaa
cccgcgcattttcccgatccggtgtatgatttgagtacaaatccgctgaccgaggaaggg
atcgagctggggaagttcctgttttacgatggtatcctgtcgcgtaccaaccagatcggc
tgcggcacctgccatcagcaggaggctgcatttacccatcacgggcatgagctcagtcat
ggcgtcgacgatctgcttgggacgcgtaactcgccttcgatccagaacctggcctggaac
ccggttttcttttgggacgggggcgtgcatgatctggacaaagtcccattcaacccaatc
cagaatccggtggagatggacgaaacggtcaagaatgtgattgccaagttgcaggccacg
ccgttggctaccgccaaaaagccggtgaattatcccgaaatgttccgcaaggcatttggc
gacgatcagattaccaccgagcggatgatgaaggcactttcgcaattcatgctcacgatg
gtttcggccgaatcgcgctatgactttttcaaacagggcgatggctcggcgctgaatgcg
caggagcaggaggggctggtgctttttaaggccaaatgcagcagctgccacacgggagag
cttttcacggatcacagctttcgcaacaatgggctggtaccgctgcggctggacgataaa
gggcgttccgaaacatccggcgatccggcagataagtacaaattcaaagtgcccagtctg
cgcaatgtcggtctgacggcgccctacatgcatgacggccgctaccatacgctggaagag
gtgctggatcactacacctcggcggtgcagcagtccccgacgctcgatccgggattgcag
cgcgccgaccggaagccgggcatcgatatgaccgacagcgagaaaaagtccattatcgca
ttcctcaggacgcttagtgacgagcagttcatccgaaattccaaactttccgatcccggg
gtcgggacgaatttttag

DBGET integrated database retrieval system