KEGG   Dyadobacter fermentans: Dfer_0101Help
Entry
Dfer_0101         CDS       T00970                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dfe  Dyadobacter fermentans
Brite
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Dfer_0101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
116552..117598
Genome map
AA seq 348 aa AA seqDB search
MRLVKLGWFCIVLLISSCDKDTVAPAENAYAFEVPPHFPVPVPDAHNPMTEAGIRLGRQL
FYDRRLSANNKVSCASCHDPAKAFSDGVALSTSGVSDTQLLRHAPALFNLAWATNGLFWD
GGSTNLESQAFGPLTAHDEMAQDLYELVDELNADASYVKGFQEAFSAGITSQNVAKALAQ
FQRSLVSATSRYDDFRLGRNGAVLTPEEMSGLALVRQHCQGCHSGELFTDNGYHNNGLDS
RFDNQDHEGIFMGRYRISYDEGDLGKFKTPSLRNVTLTAPYMHDGRIPTLEKVLDHYSNG
IQHSATLDGRIPQQGFAFSAVQKTQIIAFLATLTDERFVSNPAHQKPH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcggttggtcaaactgggctggttttgcattgtcttgctaatctcctcgtgtgacaag
gatacggtggcacctgcggaaaacgcgtatgcgttcgaggtgccgccgcatttccctgtt
cctgttccggatgcgcataatcctatgactgaggccggcatccggctgggcaggcagcta
ttctatgaccggcgcttgtcggccaacaacaaggtttcctgcgcaagctgtcacgatccc
gccaaggcattcagcgacggggtcgcgcttagcacatcaggcgtgtcggacacgcagttg
ctgcggcatgcaccggcgctgttcaatctggcctgggcgaccaacggccttttctgggac
ggcggctcgactaacctggaatcgcaggcgttcgggccgctcaccgcccatgacgaaatg
gcccaggatttgtacgaactggtggatgaactcaatgcggatgcgtcgtacgtgaagggt
ttccaggaggctttttcggcaggcataacctcgcagaatgtggccaaagcgctcgcgcag
ttccagcgctcactcgtttcggcgacttcgcggtacgacgatttccggctaggacgcaac
ggcgcagtgctcactccggaagaaatgtcgggcttggcgctggtccggcagcattgccag
ggatgccattccggcgagcttttcacggacaacggctaccacaacaacgggctcgacagc
cgtttcgacaaccaggatcacgagggaatcttcatgggccgctaccggatcagctacgac
gagggtgatttgggcaaattcaaaacgccgtcgcttcgcaatgtaacgctcacagcaccc
tacatgcacgacggccgcatacccacgctcgaaaaggtgctcgaccattattcaaacggc
atccagcattcggccacgctcgatggccgcatcccgcagcagggcttcgcattcagtgct
gtccagaagacccagatcatcgcctttctggcaacattgacagacgagcggttcgtaagc
aaccccgcgcatcagaaaccacattag

DBGET integrated database retrieval system