KEGG   Dyadobacter fermentans: Dfer_0139Help
Entry
Dfer_0139         CDS       T00970                                 

Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
dfe  Dyadobacter fermentans
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dfe01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:dfe00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:dfe00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
152687..153874
Genome map
AA seq 395 aa AA seqDB search
MCQNHGVAYIKPGEVEIQEIEYPKLALGDRKCEHGVILKIVSTNICGSDQHMVRGRTTAP
AGLVLGHEITGLVIEAGRDVEFIKVGDLVSVPFNIACGRCRNCKEGKTGICLNVNPSRPG
AAYGYVDMGGWVGGQAEYVMVPYADFNLLKFPDKDQAMAKIKDLTLLSDIFPTGFHGAVT
AGVGPGSIVYVAGAGPVGLACAASCHLLGAAVVIVGDMIPERLAQAASFGCEVIDLTKDT
PLEQAIAEIVGVPEVDCFVDCVGFEARGHGAHAVEERPATVLNTAMAVTRAGGAIGIPGL
YVTGDPGARDTAAKEGSLSIRIGLGWAKSHSFYTGQCPVMKYHRNLMNAILWDKIQIAKA
VNVEVISLQDAPRGYADFDKGAAKKFVIDPHGMIV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtgccaaaatcatggagtagcttacattaaaccgggagaagtggagattcaggaaatt
gaatatcctaaactggcgcttggcgaccgcaaatgcgagcacggcgtgatcctgaaaatc
gtttctaccaacatttgcggtagcgaccagcacatggttcgcggacgtacaacagcaccg
gcagggcttgtgctcggtcatgaaatcaccggtctggtgatcgaagcgggccgcgatgtt
gagttcattaaagtgggcgatctcgtttccgtaccgttcaacattgcctgcgggcggtgc
cgtaattgcaaagagggtaaaaccggtatttgcctcaatgtgaacccttcgcgccccggc
gctgcgtatgggtatgtggatatgggcggctgggtaggcggccaggccgagtacgtgatg
gtgccctacgccgatttcaacctgctgaaattccccgacaaggaccaggcgatggccaaa
atcaaggaccttacgctgctttccgatattttcccgaccggtttccacggtgctgttacg
gccggggtaggcccgggctccattgtgtatgtggccggcgcggggcctgtgggccttgcc
tgtgcggcttcctgccatttgcttggcgctgccgttgtgatcgtcggggatatgattccc
gagcgccttgcccaggcggcgagcttcggctgcgaggtgatcgatctcacgaaggatacg
ccgctggaacaggccatagccgaaatcgtgggtgttcccgaagtagattgtttcgtcgac
tgcgtgggtttcgaagcccgtggtcatggtgcgcatgccgtcgaagagcgccccgctacc
gttttgaacacggctatggccgttacccgggccggcggcgctattggtattccgggcctc
tacgttaccggcgacccgggtgcccgcgatactgcggccaaggaaggcagcctcagcata
cggatcggcctcggatgggccaaatcgcattcattctacaccggccaatgcccggtgatg
aagtaccatcggaatttaatgaatgcgattttgtgggataagattcaaatcgcaaaggct
gtcaatgtggaagtaatctcactgcaagacgcgccgagaggttatgcggatttcgacaaa
ggagccgcgaagaagtttgtgatcgatccgcatgggatgattgtttaa

DBGET integrated database retrieval system