KEGG   Dyadobacter fermentans: Dfer_0223Help
Entry
Dfer_0223         CDS       T00970                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dfe  Dyadobacter fermentans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dfe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250309..251160
Genome map
AA seq 283 aa AA seqDB search
MLQVSKKTLNIRGTLLDLSTPVVMGIINITPDSFYAGSRAAATDEIVEKAGQMLTDGAGM
IDIGGYSTRPGAREVGAEEEADRVESAVEPLAKFFPDLIISVDTFRAGVAERGIAKGAHI
INDVAGGTLDDAMFETVARLRVPYILMHMRGTPQTMNQLTHYDRLVPNILRDLRVKVMIL
QSNGVADVIIDPGFGFAKTIAQNFELLRALDQFKLLGYPVLVGISRKKKIYKTLNISPDE
ALNGTTVLNTLALERGASILRVHDVKPAVEAVKLWMAAGNYPN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagttagtaaaaaaacgctcaatatccggggcacgctgctcgatctgtcgacg
cccgtggtgatgggtattatcaatattacgcccgattcgttttacgccggcagccgcgcc
gccgcgaccgacgagatcgtcgaaaaagccggccagatgctgaccgacggagccggtatg
atcgacatcggcgggtattccacacgccccggcgcccgcgaggtgggcgcggaggaggag
gccgatcgcgtggagtcggcggtggagccattagctaaatttttccctgatctcatcatt
tctgttgatacctttcgggccggagtggcggaaaggggcattgccaaaggcgcacatatt
attaatgacgtggccggcggcacgctcgatgacgccatgttcgaaaccgttgcccgcctg
cgtgtgccgtacatactcatgcacatgcgcggaacaccgcaaacgatgaaccagctcacg
cattatgaccgcctcgtgccgaacatcctgcgcgacctgcgcgtaaaagtgatgatcctt
caaagcaacggcgtggccgacgtgatcatcgatccgggtttcggttttgccaaaaccatc
gcgcagaacttcgagctactgcgggcgctggaccagttcaaattgctcggttacccggtg
ctcgtgggtatctcgcgcaagaagaagatttacaaaacattgaatatttcgcccgatgaa
gcgttaaacgggacaacggtgctgaacacgctcgcattggagcggggtgcttcgatcctc
cgtgtgcatgatgtaaaaccggccgtggaagcggtaaaactatggatggccgccggtaac
tatccaaattaa

DBGET integrated database retrieval system