KEGG   Dyadobacter fermentans: Dfer_0223Help
Entry
Dfer_0223         CDS       T00970                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dfe  Dyadobacter fermentans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dfer_0223
Enzymes [BR:dfe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Dfer_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250309..251160
Genome map
AA seq 283 aa AA seqDB search
MLQVSKKTLNIRGTLLDLSTPVVMGIINITPDSFYAGSRAAATDEIVEKAGQMLTDGAGM
IDIGGYSTRPGAREVGAEEEADRVESAVEPLAKFFPDLIISVDTFRAGVAERGIAKGAHI
INDVAGGTLDDAMFETVARLRVPYILMHMRGTPQTMNQLTHYDRLVPNILRDLRVKVMIL
QSNGVADVIIDPGFGFAKTIAQNFELLRALDQFKLLGYPVLVGISRKKKIYKTLNISPDE
ALNGTTVLNTLALERGASILRVHDVKPAVEAVKLWMAAGNYPN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagttagtaaaaaaacgctcaatatccggggcacgctgctcgatctgtcgacg
cccgtggtgatgggtattatcaatattacgcccgattcgttttacgccggcagccgcgcc
gccgcgaccgacgagatcgtcgaaaaagccggccagatgctgaccgacggagccggtatg
atcgacatcggcgggtattccacacgccccggcgcccgcgaggtgggcgcggaggaggag
gccgatcgcgtggagtcggcggtggagccattagctaaatttttccctgatctcatcatt
tctgttgatacctttcgggccggagtggcggaaaggggcattgccaaaggcgcacatatt
attaatgacgtggccggcggcacgctcgatgacgccatgttcgaaaccgttgcccgcctg
cgtgtgccgtacatactcatgcacatgcgcggaacaccgcaaacgatgaaccagctcacg
cattatgaccgcctcgtgccgaacatcctgcgcgacctgcgcgtaaaagtgatgatcctt
caaagcaacggcgtggccgacgtgatcatcgatccgggtttcggttttgccaaaaccatc
gcgcagaacttcgagctactgcgggcgctggaccagttcaaattgctcggttacccggtg
ctcgtgggtatctcgcgcaagaagaagatttacaaaacattgaatatttcgcccgatgaa
gcgttaaacgggacaacggtgctgaacacgctcgcattggagcggggtgcttcgatcctc
cgtgtgcatgatgtaaaaccggccgtggaagcggtaaaactatggatggccgccggtaac
tatccaaattaa

DBGET integrated database retrieval system