KEGG   Dyadobacter fermentans: Dfer_0386Help
Entry
Dfer_0386         CDS       T00970                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dfe  Dyadobacter fermentans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(442298..443593)
Genome map
AA seq 431 aa AA seqDB search
MRLELVRVITLSITGFDAPLLKSGLDEAHVSLQTIETVLRPYMAHAGNDSVRRSLASCEA
WLTDHRDFDTFDHLRFLTEHALPLQEQLGGMIAGMGLEINEKGVLNYRAKNIFSPDILNM
NAFRKNAGGDSALTELGRKLFFETRLSANGTRSCASCHNPALHFTDGLPKSNGIHPGQAT
RRNAPTLLYSSFQHAQFWDGRSATLEDQVRAVIHDSLEMNGKPIETIRKLARSRSYRRLI
RKVAPDRRDVNDTLVYRAIAAYVGTLKPFNSNFDRYMAGDRAALTDGQKRGFNLFMGKAQ
CGTCHFAPLFNGLIPPLYTLTEFEILGTTATDDLEHPQADADSGRFETRPTPYYQRAFKT
PTVRNAAVTAPYMHNGAFASLEKVIDFYDRGGGAGLGLDVPHQTLAAEPLNLTDQEKSDI
IAFLEALTDPL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtttagagctcgtgcgggtgattacattgagcattaccggcttcgacgcgcccttg
ttgaaaagcgggctggacgaagcacacgtttcgctgcaaacgatcgaaacggttttgcgg
ccttacatggcccatgccggaaacgattcggtacgcagatctctcgcttcgtgcgaggca
tggctgactgatcatcgtgactttgatacattcgatcacctgcgttttctcacggaacat
gcattgcccttgcaggagcagcttggcgggatgattgccggaatgggactggaaatcaat
gaaaaaggagttttgaactaccgcgccaaaaacattttcagcccggatattttgaatatg
aatgcatttaggaaaaatgcaggcggcgacagtgcattgaccgagctaggcagaaaactg
ttttttgaaacaagattgtcggccaatggcacccggagctgcgcttcctgccacaatccg
gcgctgcacttcacggacgggctgccaaaaagcaacggtatccatcccggccaggccacg
cggcgtaatgcgccgacgctgctgtacagctcatttcagcacgcccagttttgggatggc
cggtcggcaacgctcgaagaccaggtgcgggccgtgatccacgacagtctggaaatgaat
ggcaagcctatcgaaacgatccgcaaactggcgcggagccggtcctaccggcggctgatc
aggaaggttgcgcccgaccgccgggatgtgaacgatacgctggtgtaccgggcgatagcg
gcgtatgtaggcacgctcaaaccattcaattcgaatttcgaccggtatatggccggcgac
cgcgccgctctgaccgacggccagaagcgcggcttcaacctcttcatgggcaaggcgcaa
tgcggcacctgccattttgcaccgcttttcaatggcctgatcccgccgctgtacacgctc
accgagttcgaaatactcggcaccacggccacggacgacctggaacacccgcaagccgat
gccgactcaggccgcttcgaaacccggccgacgccctactaccagcgcgcgttcaaaaca
cccaccgtacggaatgccgccgtgacggccccctacatgcacaacggggcctttgcaagc
ctcgaaaaggtgatcgacttttatgaccgcggcggcggtgccgggctgggcctagacgtg
ccgcaccaaacgcttgccgcagaacccttgaaccttaccgatcaggagaaatcagatatc
attgcctttttagaagcgctcaccgatcctttatga

DBGET integrated database retrieval system