KEGG   Dyadobacter fermentans: Dfer_0451Help
Entry
Dfer_0451         CDS       T00970                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dfe  Dyadobacter fermentans
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dfe01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dfe01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
514864..515610
Genome map
AA seq 248 aa AA seqDB search
MYIVLIVFVVHWYLSLFCQTFFLHRYSAHKMFIMSKPWERFFYLLTYVSQGSSYLSPRAY
AILHRMHHAFSDTDKDPHSPHHTKNVFTMMWETKNIYNAVLNRKRAIENRFERNYPEWRL
IEKLGDSWISRAGWGILYIVFYVLAYIYLDMHWAFFFLLPIHFLMGPIHGAIVNWSGHKY
GYQNFDNDDKSKNSLIFDFLMMGELFQNNHHKRPNSINFGSRWFEIDPTYPVIKVLNKLK
IIEIRKKH
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtatatagttctcattgtatttgttgtacattggtatttgtcactattctgtcaaacc
ttcttcctgcatcgctattctgctcataaaatgttcataatgagcaagccctgggaacgg
ttcttctatttgctaacctacgtttcacaaggttcgtcgtacctgagcccccgtgcctac
gcgatcctgcaccgcatgcaccatgctttcagcgataccgataaagacccgcattctccg
caccacacaaagaatgtttttacgatgatgtgggagactaaaaacatttacaatgccgta
ctgaaccgcaagcgtgccatcgaaaaccgtttcgaacgtaattatccggaatggagactg
atcgagaaattgggtgattcatggatttcaagagctggctggggcattttgtacatcgta
ttttacgtgctggcctatatttacctggatatgcactgggcattcttcttcctgttgccg
atccacttcctgatgggcccgatccacggagcgatcgtaaactggagcggacacaaatat
ggctaccagaacttcgataacgacgataaatctaaaaactccctgatcttcgatttcctg
atgatgggcgagcttttccagaacaaccaccacaaacgtccgaattccatcaatttcggc
tcaagatggttcgaaatcgacccgacttacccggtaatcaaggtgctgaacaagttgaag
attattgaaattcgaaagaagcactag

DBGET integrated database retrieval system