KEGG   Dyadobacter fermentans: Dfer_0468Help
Entry
Dfer_0468         CDS       T00970                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dfe  Dyadobacter fermentans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dfe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
530751..531395
Genome map
AA seq 214 aa AA seqDB search
MDVEEIGDDHLFSGIETPLRPDAFAMEDELKMELIEKHFRHIMEIMGLDMTDDSLKGTPK
RVAKMYIKEVFSGLDPKNKPAVALFDNKYKYNQMLVEKDISVFSNCEHHFVPIYGKAHVA
YISSGKVIGLSKLNRIVEYFSKRPQVQERLTVQIANELKQALQTEDVAVVIDAQHMCVQS
RGIRDSGSSTVTAFYGGKFEEEATKKEFLAYLGM
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
ttggatgttgaagagattggtgacgatcatttgttttcaggaattgagacgccccttcgc
cccgatgcttttgcgatggaggatgaacttaaaatggagctcatcgagaagcatttccgc
catatcatggagattatgggcctggatatgaccgacgatagcctcaaaggcacgccaaaa
agggttgcgaaaatgtatatcaaggaagttttcagcggcctggacccgaagaacaagccg
gctgttgcactttttgacaataaatataaatataaccaaatgctcgttgagaaggacatt
tcggtgttttccaactgcgagcaccactttgttccgatttacggaaaggcgcatgtagcc
tatatttcgagcggaaaagtgatcggtttgtcgaagctgaaccgcattgtcgagtacttt
tccaagcgcccgcaggttcaggaacgcctcaccgtgcagatcgccaatgagctgaaacag
gcattgcaaaccgaggacgtggccgtcgtgatcgacgcgcagcacatgtgtgtgcagtcg
cgaggcatacgcgactccggtagctccaccgttaccgctttttatggcggaaagttcgag
gaagaggcgaccaagaaggagtttttggcctatttgggaatgtag

DBGET integrated database retrieval system