KEGG   Dyadobacter fermentans: Dfer_0468Help
Entry
Dfer_0468         CDS       T00970                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00790  Folate biosynthesis
dfe01100  Metabolic pathways
Module
dfe_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dfer_0468
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Dfer_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACT91737
UniProt: C6VZC5
Position
530751..531395
Genome map
AA seq 214 aa AA seqDB search
MDVEEIGDDHLFSGIETPLRPDAFAMEDELKMELIEKHFRHIMEIMGLDMTDDSLKGTPK
RVAKMYIKEVFSGLDPKNKPAVALFDNKYKYNQMLVEKDISVFSNCEHHFVPIYGKAHVA
YISSGKVIGLSKLNRIVEYFSKRPQVQERLTVQIANELKQALQTEDVAVVIDAQHMCVQS
RGIRDSGSSTVTAFYGGKFEEEATKKEFLAYLGM
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
ttggatgttgaagagattggtgacgatcatttgttttcaggaattgagacgccccttcgc
cccgatgcttttgcgatggaggatgaacttaaaatggagctcatcgagaagcatttccgc
catatcatggagattatgggcctggatatgaccgacgatagcctcaaaggcacgccaaaa
agggttgcgaaaatgtatatcaaggaagttttcagcggcctggacccgaagaacaagccg
gctgttgcactttttgacaataaatataaatataaccaaatgctcgttgagaaggacatt
tcggtgttttccaactgcgagcaccactttgttccgatttacggaaaggcgcatgtagcc
tatatttcgagcggaaaagtgatcggtttgtcgaagctgaaccgcattgtcgagtacttt
tccaagcgcccgcaggttcaggaacgcctcaccgtgcagatcgccaatgagctgaaacag
gcattgcaaaccgaggacgtggccgtcgtgatcgacgcgcagcacatgtgtgtgcagtcg
cgaggcatacgcgactccggtagctccaccgttaccgctttttatggcggaaagttcgag
gaagaggcgaccaagaaggagtttttggcctatttgggaatgtag

DBGET integrated database retrieval system