KEGG   Dyadobacter fermentans: Dfer_0486Help
Entry
Dfer_0486         CDS       T00970                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dfe  Dyadobacter fermentans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dfe00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dfe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(546951..548885)
Genome map
AA seq 644 aa AA seqDB search
MFRKTGQLLLWLLIHFTVRAQVQAVEQQFVVAQDGSGDFKTIQEAVNAVRDHSQIRATIR
IKSGTYREKLVIPAWKKNITLIGESAEHTIITNNDFSGKDFPGRDFTGNAKFSTYTSYTV
LVQANDCTLQNLTIENTAGRVGQAVALATEGDRIEVFNCRILGNQDTLYTSKNGRNFFRD
CLITGTTDFIFGEATAVFQNCTIHSLTNSYITAASTTSEQAFGYVFFNCKLTAAGEATKV
YLGRPWRPFAKTVFIDTEMGAHIVPAGWDPWKGDNMFPEKEKTAFYAEYNSTGPGANAQA
RAPWTKQLTAGEREQYTIDHILSGWTPGRKLRLQPSGVPDTSFSVKGSYRQEHPRRPDIR
IADAPRPASVQEIRQVPYRTTPMDKQLLIDIYKPAKKGKTRHPAVLMVHGGGWRSGDRTH
NTHLARKLAAKGYVCITADYSLSTQALYPAAIHDLKAAVRWMRTNAQEYGIDTARIAIMG
FSAGGELAAFIGATNGNGQFEGERGEEKPSSTVQAVVDIDGILAFIHPESGEGNDSRSVS
AATYWFGYPKTERPDLWKEASPLTHVTAQTPPFLFINSSVDRMHAGREDFIQKLNAFGTY
SEVRTFADAPHTFMFFDPWFEPTLATISGFLDKVLNPKSTSGKK
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggaaaaccggtcagctcttgctatggttgctcatccatttcaccgtccgcgct
caggtacaggccgttgagcagcaattcgtagttgcgcaggacggcagcggcgatttcaaa
acgatacaggaagcggtgaatgccgtacgcgaccattcgcagatccgcgccacgatacgc
attaaaagcgggacttatcgtgaaaaactggtgatacccgcctggaaaaagaatatcaca
ctcatcggcgaaagcgccgaacataccattattacaaacaacgacttttcgggcaaggac
tttcccggccgcgattttacaggtaatgcgaagtttagcacctacacctcatacaccgtg
ctcgtgcaggccaacgactgcacccttcaaaacctgaccatcgaaaacaccgcaggccgt
gtgggtcaagcggttgcattggcgaccgagggcgaccggatcgaagttttcaattgtcgc
atcctcggcaaccaggatacgctctatacctccaagaacggccggaatttcttccgcgac
tgccttatcaccggcaccaccgacttcattttcggtgaagcgacggccgtttttcagaac
tgcaccatccacagtctcaccaactcctacatcaccgccgcctccacaaccagtgaacag
gcattcggctacgtgtttttcaactgcaaactcaccgcagccggcgaagccaccaaagta
tacctgggccgaccgtggaggccttttgccaaaaccgttttcatagacaccgaaatgggc
gcgcacatcgtgcccgcaggctgggacccctggaaaggcgataacatgttccccgaaaag
gaaaaaaccgcattctacgccgaatacaacagcacaggcccgggtgccaacgcccaggca
cgtgcaccctggacaaagcaactgaccgccggcgaaagggagcaatacacgatagaccat
atactttcgggatggacaccgggccgcaagcttcgtttgcagccctccggcgtacccgac
acgagcttttccgtgaagggctcctaccgccaggaacacccccgacgccccgacatccgc
attgcagacgcgcccagaccggcttcggtgcaggagatacgccaggtgccctaccgcacc
acgccgatggacaagcagctgctgatcgacatttataagcctgctaaaaagggtaaaacg
cgccacccggccgttctcatggtacacggtggtggctggcgctcgggcgaccgcacgcac
aacacccacctcgcacgcaagctcgccgcgaaaggttacgtctgtattacagccgattac
agcctgtccacgcaagccctctaccccgccgccattcacgaccttaaagctgccgtgcgc
tggatgcgcaccaatgctcaggaatacggcattgataccgcccgcattgccataatgggt
ttctcggccggcggagaactggccgcttttataggtgccacaaatgggaatggacaattt
gaaggcgagcgcggtgaagaaaagccatccagcacggtgcaggcggtggtcgacattgac
ggcattctggcgttcatccaccccgaatcgggcgaaggcaacgattcccggtctgtttct
gccgctacttactggtttggttatcccaaaaccgagcgccccgacctttggaaggaggcc
tcgccgctcacgcacgtgaccgctcaaacaccgccttttctgtttatcaacagctctgtg
gaccggatgcatgccgggcgggaggattttattcaaaaactgaatgcattcggcacatac
agcgaggtacggacattcgctgatgccccgcacacatttatgttttttgatccgtggttt
gagcctacgctagccactatttccggttttttggataaggtgttaaacccaaaatccaca
agcggaaagaaatag

DBGET integrated database retrieval system