KEGG   Dyadobacter fermentans: Dfer_0486Help
Entry
Dfer_0486         CDS       T00970                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dfe  Dyadobacter fermentans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dfer_0486
   00500 Starch and sucrose metabolism
    Dfer_0486
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Dfer_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(546951..548885)
Genome map
AA seq 644 aa AA seqDB search
MFRKTGQLLLWLLIHFTVRAQVQAVEQQFVVAQDGSGDFKTIQEAVNAVRDHSQIRATIR
IKSGTYREKLVIPAWKKNITLIGESAEHTIITNNDFSGKDFPGRDFTGNAKFSTYTSYTV
LVQANDCTLQNLTIENTAGRVGQAVALATEGDRIEVFNCRILGNQDTLYTSKNGRNFFRD
CLITGTTDFIFGEATAVFQNCTIHSLTNSYITAASTTSEQAFGYVFFNCKLTAAGEATKV
YLGRPWRPFAKTVFIDTEMGAHIVPAGWDPWKGDNMFPEKEKTAFYAEYNSTGPGANAQA
RAPWTKQLTAGEREQYTIDHILSGWTPGRKLRLQPSGVPDTSFSVKGSYRQEHPRRPDIR
IADAPRPASVQEIRQVPYRTTPMDKQLLIDIYKPAKKGKTRHPAVLMVHGGGWRSGDRTH
NTHLARKLAAKGYVCITADYSLSTQALYPAAIHDLKAAVRWMRTNAQEYGIDTARIAIMG
FSAGGELAAFIGATNGNGQFEGERGEEKPSSTVQAVVDIDGILAFIHPESGEGNDSRSVS
AATYWFGYPKTERPDLWKEASPLTHVTAQTPPFLFINSSVDRMHAGREDFIQKLNAFGTY
SEVRTFADAPHTFMFFDPWFEPTLATISGFLDKVLNPKSTSGKK
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggaaaaccggtcagctcttgctatggttgctcatccatttcaccgtccgcgct
caggtacaggccgttgagcagcaattcgtagttgcgcaggacggcagcggcgatttcaaa
acgatacaggaagcggtgaatgccgtacgcgaccattcgcagatccgcgccacgatacgc
attaaaagcgggacttatcgtgaaaaactggtgatacccgcctggaaaaagaatatcaca
ctcatcggcgaaagcgccgaacataccattattacaaacaacgacttttcgggcaaggac
tttcccggccgcgattttacaggtaatgcgaagtttagcacctacacctcatacaccgtg
ctcgtgcaggccaacgactgcacccttcaaaacctgaccatcgaaaacaccgcaggccgt
gtgggtcaagcggttgcattggcgaccgagggcgaccggatcgaagttttcaattgtcgc
atcctcggcaaccaggatacgctctatacctccaagaacggccggaatttcttccgcgac
tgccttatcaccggcaccaccgacttcattttcggtgaagcgacggccgtttttcagaac
tgcaccatccacagtctcaccaactcctacatcaccgccgcctccacaaccagtgaacag
gcattcggctacgtgtttttcaactgcaaactcaccgcagccggcgaagccaccaaagta
tacctgggccgaccgtggaggccttttgccaaaaccgttttcatagacaccgaaatgggc
gcgcacatcgtgcccgcaggctgggacccctggaaaggcgataacatgttccccgaaaag
gaaaaaaccgcattctacgccgaatacaacagcacaggcccgggtgccaacgcccaggca
cgtgcaccctggacaaagcaactgaccgccggcgaaagggagcaatacacgatagaccat
atactttcgggatggacaccgggccgcaagcttcgtttgcagccctccggcgtacccgac
acgagcttttccgtgaagggctcctaccgccaggaacacccccgacgccccgacatccgc
attgcagacgcgcccagaccggcttcggtgcaggagatacgccaggtgccctaccgcacc
acgccgatggacaagcagctgctgatcgacatttataagcctgctaaaaagggtaaaacg
cgccacccggccgttctcatggtacacggtggtggctggcgctcgggcgaccgcacgcac
aacacccacctcgcacgcaagctcgccgcgaaaggttacgtctgtattacagccgattac
agcctgtccacgcaagccctctaccccgccgccattcacgaccttaaagctgccgtgcgc
tggatgcgcaccaatgctcaggaatacggcattgataccgcccgcattgccataatgggt
ttctcggccggcggagaactggccgcttttataggtgccacaaatgggaatggacaattt
gaaggcgagcgcggtgaagaaaagccatccagcacggtgcaggcggtggtcgacattgac
ggcattctggcgttcatccaccccgaatcgggcgaaggcaacgattcccggtctgtttct
gccgctacttactggtttggttatcccaaaaccgagcgccccgacctttggaaggaggcc
tcgccgctcacgcacgtgaccgctcaaacaccgccttttctgtttatcaacagctctgtg
gaccggatgcatgccgggcgggaggattttattcaaaaactgaatgcattcggcacatac
agcgaggtacggacattcgctgatgccccgcacacatttatgttttttgatccgtggttt
gagcctacgctagccactatttccggttttttggataaggtgttaaacccaaaatccaca
agcggaaagaaatag

DBGET integrated database retrieval system