KEGG   Dyadobacter fermentans: Dfer_0693Help
Entry
Dfer_0693         CDS       T00970                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
dfe  Dyadobacter fermentans
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:dfe00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
818300..820276
Genome map
AA seq 658 aa AA seqDB search
MKTIQYIIGAASVAVALSAAQSCKPKSADTAISGDAAAKTYVAPGKYDEFYNFVSGGFSG
QLSVYGIPSGRLLRVIPVFSMDPEKGWGFSEETKPMLNTSHGNVPWDDLHHVQLSKTNGE
NDGRWVFVNGNNTPRLARIDLKTFRTAEILELPNSGGNHSSPFITENTEYVVAGTRFSVP
MDEVDGDVPINTYKKNFRGTLSFVSVNQQDGNMDIAFQIETPGVNFDLSRSGKGPSHGWF
FFSCYNTEQANTLLEVNASKNDKDFIMAVNWKKAEEYLKAGKGRKVKVKYAHNKYSEESH
TSTSEIKNEVVVLSSKELKDLCYFIPCPKSPHGIDIDPTGEYMVSSGKLAALIPVFSFSK
MIKAIESKSFEGDYNGIPVIKYEAALYGEVQKPGLGPLHTEFDGRGNAITTMFVSSEIVK
WNIKDLKVIDRQPTFYSPGHLMIPGGDSKKPDGKYVISYNKITKDRFLPTGPELAQSAQL
FDISGDKMQLILDFPTIGEPHYAQAIRAEKVKDQSLKTFKLEANKHPYASRGEGETKIVR
DKNKVHVYMTAIRSHLTPDNIEGVKMGDEVYFHVTNLEQDWDVPHGFAVKGASNGELLVM
PGETQTLKWVPDRVGIFPIYCTDFCSALHQEMSGYVRVSPASSKVALVGNTGTNLPAE
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatccagtatatcataggagcggcctcggtggccgtggcactgagcgccgcc
cagtcctgtaagcccaaaagtgccgacacggcgatcagcggtgacgctgctgcgaaaacc
tacgttgcgccgggcaagtacgacgagttctacaacttcgtttccggcggtttcagcggg
cagctctccgtatatggcattccgtcgggcaggctgctgcgggtgatcccggtgttttcg
atggaccccgagaaaggctgggggttcagcgaggaaacgaagccgatgctcaatacctcg
cacggaaatgtcccctgggacgatctgcaccacgtgcagctttcgaaaacgaacggggag
aatgacggccgctgggtattcgtgaacggcaacaacacgccccgcctggcgcggatcgac
ctgaaaacgttccgcaccgccgaaatcctcgaactgcccaacagcggcggtaaccactcc
tcgccatttatcaccgaaaacacggaatatgtggtggccggaacgcgtttcagcgtgccg
atggacgaggtcgacggcgacgtgcctattaatacttataaaaagaatttcaggggcacg
ctcagctttgtgagtgtaaaccagcaggatggcaacatggacatcgccttccagatcgag
acgcccggtgtgaacttcgacctcagccggtcgggcaaggggccgtcgcacggatggttt
ttcttctcgtgctacaacaccgagcaggccaatacgctgctggaagtgaatgcctcgaaa
aacgacaaggacttcattatggccgtgaactggaaaaaggccgaagaatacctgaaagcc
ggaaaaggcaggaaagtgaaggtgaaatatgcgcataataaatacagcgaagaaagccat
acctctacctccgaaatcaaaaacgaagtggtggtgctcagttccaaagagttgaaagac
ctgtgctacttcattccatgtcccaaatccccgcacggcatcgacatcgacccgacgggc
gagtacatggtgagcagcggcaaactggccgcgctgatcccggtattctcattttccaaa
atgatcaaggcgatcgaaagcaaatccttcgagggtgattacaatggtattcctgtgatc
aaatatgaagcggcgctgtatggcgaggtgcaaaagccgggacttgggccgctgcatacc
gaattcgacgggcgtggtaatgcgattactacgatgttcgtatcctccgaaatcgtgaaa
tggaacatcaaggacctgaaagtgatcgaccgtcagccgacattctattcgcccggccac
ctgatgatccccggcggcgactcgaaaaagccggacggtaaatatgtgatttcctacaac
aaaatcaccaaagaccgcttcctgccaaccgggccggaactcgcccagagcgctcagctt
ttcgacatttcgggtgataaaatgcagctgatactcgacttcccgaccatcggcgagccg
cattatgcacaggcgatcagggccgaaaaggtgaaggaccaatcgttgaaaacgttcaag
ctggaagccaacaagcacccttatgcatccagaggcgaaggagaaacgaagatcgttcgt
gacaaaaacaaggtgcacgtgtacatgaccgccatacgctcgcacctcacgcccgacaac
atcgaaggcgtgaagatgggcgacgaggtgtacttccacgtcaccaatctggaacaggac
tgggatgtgccgcacggcttcgctgtgaaaggcgccagcaacggcgagctgctggtaatg
cccggcgaaacgcagacgctcaaatgggtgccggaccgtgtgggtattttcccgatctac
tgcaccgacttttgcagcgcattgcaccaggaaatgtccggctacgttcgcgtgtctccg
gcgtcgagcaaagttgcattggtaggaaatacgggcactaacctgcctgcggaatag

DBGET integrated database retrieval system