KEGG   Dyadobacter fermentans: Dfer_0796Help
Entry
Dfer_0796         CDS       T00970                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
dfe  Dyadobacter fermentans
Brite
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Dfer_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939986..941065
Genome map
AA seq 359 aa AA seqDB search
MKLFKLHSFIRYIAVGAAMLPSDVFAQKTLKEAYKTYFPIGVAVAPRSLLGPESELIKAQ
FSSITPENAMKMGPIHPEPNRYDWRDADAIVAFGQANNMLVRGHTLCWHSQAPRWFFTDA
QGQQVSREELLARLKQHITDVVSRYKGKIYAWDVVNEAVPDTGNSIYRSSKFYQIIGEEY
IEKAFEYAHAADPDAKLFYNDYNTESAAKREKIYQLLKKLKAKKIPVHGVGLQGHWSIYE
PTRQELEKSIEDFASLGLAVQITELDVSVYPKEHERRKKNELDKAIYTDEMMQKQSAHYQ
MLFDTFRKYKSTVTGVTFWNVSDRSSWLDNFPVQGRKDFPLLFDQHYKPKQAFEGVVNF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagttattcaaattgcattcattcattcgttatatcgctgtcggcgctgcaatgctc
ccgtccgatgtttttgcgcaaaaaacactcaaagaggcctacaaaacgtacttcccaatt
ggtgtagcggtggcccccagaagcttgttaggcccggagtccgagcttataaaagcgcag
ttcagtagcatcaccccggagaatgcgatgaagatggggcctattcatcccgagccaaac
cgttatgactggcgcgatgcggatgccatcgtcgcgttcggtcaggcaaacaatatgctg
gtcagggggcacaccttgtgctggcacagccaggcgccccgatggttttttacagatgcc
cagggacagcaggtttccagagaagagctgctggcgcgtttaaaacagcacattacagac
gtcgtgagccggtacaagggtaaaatttatgcctgggatgtcgtcaacgaagcggtgccg
gatacgggaaacagtatctatcgttcgtcaaagttttatcagatcattggtgaagagtac
atcgaaaaagcattcgaatatgcccacgcggccgatccggatgccaaactgttttacaat
gactacaacacagaaagcgcagcaaaaagggagaaaatttaccaactgctcaaaaagctg
aaagcgaaaaagattccggtgcacggtgtcgggttgcaggggcattggtcgatctacgag
ccgacccggcaggagctcgaaaagtcgatcgaggactttgccagtctgggcctggccgtt
cagattacggagctggatgtttcggtgtatcccaaagagcatgagcgccgtaagaaaaac
gaacttgacaaagccatttataccgatgaaatgatgcagaagcagtccgcccattatcaa
atgctttttgatacattccgcaaatacaaaagcacggtaactggcgtcactttctggaac
gtatcggaccggtcgagttggctggataacttcccggttcaggggcgtaaagacttcccc
ttgctgtttgaccagcattacaaacctaagcaggcctttgagggggtagtgaatttttga

DBGET integrated database retrieval system