KEGG   Dyadobacter fermentans: Dfer_1141Help
Entry
Dfer_1141         CDS       T00970                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
dfe  Dyadobacter fermentans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dfer_1141
  Amino acid metabolism
   00340 Histidine metabolism
    Dfer_1141
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Dfer_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1359250..1360518)
Genome map
AA seq 422 aa AA seqDB search
MNIIPFPEREQWPALLARPVLEARDIEARVQPVLEQVKNEGDAGIKALALKFDKIELTDL
AFSEKDIAEAGDKLDDALKAAIGQAYENICKFHKGQLQAPEKVETMPGVTCWRKSVGIEK
VGIYIPGGSAPLFSTVLMLGIPAQIAGCKEVVLCTPSDHPAILYAAKLVGVTKAFRIGGA
QAIAAMAYGTESVPKVYKIFGPGNQYVTTAKMLVSKEGVAIDMPAGPSEVAIFADDTALP
CFVAADLLSQAEHGADSQVLLVSTSKKLLASVNIALAEQLEALPRKDLAAQAMANSKAIL
VETGDEAIEMLNQYAAEHLILSIANAEAVTEKIYNAGSIFLGNYTPESCGDYASGTNHTL
PTNGYARAYSGVSVDSFVKKITVQHITEEGIRNIGPVVEAMAEAESLDAHKKAVTIRLKS
LL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcattccatttccggaaagggaacaatggcccgcattgctggcacggcccgtt
ctggaagccagggacatcgaagcgcgggtgcagcctgtgctcgaacaagtgaaaaatgaa
ggcgacgcaggcattaaagccctcgccctgaaattcgataaaatagaactgaccgacctc
gcattctccgaaaaggacattgccgaggctggcgacaagctcgacgacgcgttgaaagcg
gcgatcggtcaggcttacgagaatatctgcaaattccacaaaggccagctccaggcgccc
gagaaggtggaaaccatgcccggcgtgacctgctggcgtaaaagcgtggggatcgaaaag
gtggggatttatattcccggcggctcggcgccactgttcagtacggtgctgatgctcggt
attccggcgcaaattgctggttgcaaggaagtggtgctctgcacaccgtccgatcacccg
gcgattttatatgcggccaaactcgtgggcgtaaccaaggcattccgcatcggcggcgcg
caggcgatcgcggcgatggcctacggtactgagagcgttcccaaagtttacaagatattt
ggtcctggaaaccagtacgttaccactgccaaaatgctggtaagcaaggaaggcgtggcg
atcgacatgccggccggaccgtcggaagtggcgattttcgcggacgacacggcattaccc
tgcttcgtggccgcggatttgctttcccaggccgagcacggcgccgatagccaggtactt
ctggtttctaccagtaaaaaactgcttgcctcggtgaatatcgcattggcggaacagctg
gaagcgctgccgcgtaaagacctggccgcacaagccatggcgaacagcaaggcaatcctc
gtcgaaaccggggacgaagccattgaaatgctgaaccaatatgcagccgagcacctgatt
ttgagcattgccaatgcggaagcggtaaccgaaaaaatttacaatgccggctcgatcttc
ctgggcaattacacgcccgaatcctgcggggattacgcttcgggaaccaaccatactttg
ccgaccaatggctatgcgagggcttacagcggggtatccgtggatagttttgtgaaaaaa
atcaccgttcagcatattaccgaggagggcatccgcaacatcgggcccgtggtggaagcc
atggccgaagccgaatcgctcgatgcccataagaaggcagtgaccattcgattgaaaagt
cttttgtga

DBGET integrated database retrieval system