KEGG   Dyadobacter fermentans: Dfer_1545Help
Entry
Dfer_1545         CDS       T00970                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dfe  Dyadobacter fermentans
Brite
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Dfer_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1845412..1846566)
Genome map
AA seq 384 aa AA seqDB search
MAGAGIAFLACGGERNTALKKEKEPVETIADLGALPLSAESPADNPTTVEKVGLGRLLFF
DPILSGNKDVACATCHQPEFNYAEFLETSIGVNGVGRGQSRRFVDPNDIPFVKRNSQSVL
NTAFNGIRNNEPYDPAQAPMFWDMRAKGLEQQALEPIKTLEEMRGNGFHETGIVEEVVTR
VAKIPEYRRLFSEAFPGDPAPVSQLNLARAIAAYERTLIATNTRFDQYMRGDSNALSTGE
KEGMNAFLVTGCAKCHSGPMFSDFKLHTLGVPDTENRKESDSGADQKYAFRTPTLRNLRF
TAPYMHSGKFQTLDQVLMFYEDIAGGKLLNPNVKSGQVDPLATHMDVNFKDISRIVEFLN
TLNDDSFDKTIPESVPSGLPVMGR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggccggagcgggcattgcctttctggcctgcggcggagagcggaatacggcacttaaa
aaagagaaagaacccgtagaaacgattgccgacctgggtgcattgccgctgtcggcggaa
agcccggccgataatcctacgacggtggaaaaggtagggttagggcgcttgctgtttttt
gatccgatactctccggaaataaggatgtggcctgcgcaacctgccatcagccggagttc
aactatgccgaatttctggaaacgtccattggcgtgaacggcgtcggtagggggcaaagc
cgccggtttgtcgacccgaacgacattccctttgtgaaaagaaattcgcagagtgtgctc
aataccgccttcaacggcattcggaataatgaaccgtacgatccggcacaggccccgatg
ttttgggacatgcgtgccaaaggcctcgaacagcaggcgctcgaaccgattaaaacactg
gaagaaatgcggggaaacggcttccatgaaaccggtatcgtggaagaagttgtaacgagg
gtcgcaaagattcccgaataccgccggctgttttcggaggcatttcccggcgatcccgcg
cccgtcagccagctgaatctcgcacgcgccatcgcggcctatgagcgcacgctgatcgcc
accaacacgcgtttcgatcagtacatgcggggcgatagcaatgcattgtccaccggggag
aaggagggaatgaatgctttcctggtcacgggttgtgccaaatgccattccggtccgatg
ttctcggatttcaaactgcataccctgggcgtgcccgataccgaaaacaggaaggaaagc
gattccggcgccgatcagaaatatgcattcaggacacccacacttcgcaacctgcgcttc
acggcgccgtatatgcacagcggcaagttccagacgctcgatcaggtgctgatgttttac
gaagacatagccggaggtaagctgctcaatcccaatgtgaaatcagggcaggtagatccg
ctcgccacgcatatggacgttaatttcaaggacatttcgcggatcgtcgagtttttgaac
acactcaacgacgactcgttcgataaaaccatccccgaaagcgttccaagcggattgccg
gtaatggggcgttag

DBGET integrated database retrieval system