KEGG   Dyadobacter fermentans: Dfer_1836Help
Entry
Dfer_1836         CDS       T00970                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
dfe  Dyadobacter fermentans
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dfer_1836
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Dfer_1836
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Dfer_1836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2259581..2261185
Genome map
AA seq 534 aa AA seqDB search
MAQYVRNNAWNNGGTFDNKDLYWYARGVEAMMARPIADSASWWFYAAIHGEYANPNTPWY
PRPAAFPGWSFIQGTPQVPTTPLPDSATMDLYWNQCQHGSWYFFPWHRGYLMSLETQLRA
DIVAAGGPDTWALPYWNYFGGQGGSQSQMPPAFAAETLPEGTPNALFVTMRYGPDGDGNI
YVPCPPKYPTGPINAKAMKNDLFTGSDAVTRPPGFGGPQTTFAHNGSPHGNFESNPHDLV
HGYVGGQPGPSDAIYGIMGDPGTAALDPIFYLHHCNIDRMWEAWNDQGNSNPTVSSWTNG
PSRQFAMPTASGKPWNYTPGDVSTLANLDYSYESLGIEDAPQAPKTQPALTLAKRLETLG
ASPEASNASLEAAASTAPRKTELLGASPTALKLSKTPIEITVALDASTRKAAEVSLLKAS
VSALPDKAYLRLENVSGIYDATILGISVSTPESGGSYLVGHVALFGLRRATVSDGQHGGE
GLSFILDITPFIDELHLNNALNADAVKVAIVPDKPLPDGTEVTIGRVSIYREAF
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatacgtgcgtaacaacgcctggaacaacggcggtactttcgacaacaaagac
ctgtactggtacgccaggggcgtcgaggcgatgatggcccgtcccattgccgattctgcc
agctggtggttttatgccgccatccacggcgagtatgccaatcccaataccccgtggtat
ccccggccggccgccttcccggggtggagcttcatccagggcacaccacaggtacccacc
actcccctgcccgactccgccaccatggacctgtactggaaccagtgccaacacggaagc
tggtatttcttcccgtggcaccgcggctacctgatgtcgctggaaacccagctgcgcgcg
gacattgtagcagccggcggaccagacacctgggcgctcccctactggaactatttcgga
ggccagggtggtagccaaagccagatgccaccggcatttgcagccgaaacactgcccgaa
ggaacgcctaatgcccttttcgtgacgatgcgctacggcccggatggcgacggcaacatt
tacgtaccctgcccgcccaaatacccaaccggcccgatcaatgcaaaggccatgaaaaac
gaccttttcacaggcagcgacgcggtaacacgcccgcccggctttggcggaccgcaaacc
acatttgcccacaacggttctccgcacggtaactttgaaagcaacccgcacgatctggta
catggctatgtaggcggccagccaggcccttccgatgcgatctacggcattatgggcgac
cccggcacagccgcattagacccgattttctatctccaccactgcaatatcgaccgcatg
tgggaggcctggaatgaccagggcaacagcaatccgacggtgtccagctggacgaatggc
ccttcgcgccagtttgcgatgcctaccgcctccggcaaaccctggaactacacgccgggt
gacgtgtccacgctcgccaacctcgattacagctacgaaagcctgggtatcgaagacgca
cctcaggcccccaaaacacagccggcgcttacccttgccaaacgccttgaaaccctggga
gcgtcaccggaagcctccaatgccagcctggaagcagcggcgagcacagcaccaaggaaa
accgaactgctgggtgcaagtccaaccgctctgaaactcagcaaaacgcccatcgaaatc
actgttgcactggacgccagcacgcgcaaggccgcggaagtaagcctgctgaaagcctcc
gtcagcgcactgcccgataaagcctaccttcgcctcgaaaacgtgagcgggatttatgac
gccaccattctcggcatttcggtaagcacgcccgaaagcggcggcagttatctcgttggc
catgttgcgcttttcggcttgcggcgcgcaaccgtttcggacggccagcatggcggggaa
ggactttcctttatcctcgacatcacgccgttcatcgatgagctgcatctcaacaacgcg
ctcaatgcggacgctgtgaaagtggccatcgtgcccgacaaacccctccccgacggtacg
gaggtaaccatcggccgtgtaagcatttaccgcgaagcgttttaa

DBGET integrated database retrieval system