KEGG   Dyadobacter fermentans: Dfer_1955Help
Entry
Dfer_1955         CDS       T00970                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dfe  Dyadobacter fermentans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dfe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2390681..2392687)
Genome map
AA seq 668 aa AA seqDB search
MAKSIGKKKTNATIEPAEDAGTPVAAQSVNAVETISRFTDFDIHLFRQGKHFKLYEKLGS
HVMEVNGVVGTYFAVWAPNATYLSVVGNFNGWNHGSHSLAPRWDSSGIWEGWIPNVGVGE
VYKYYIISSNGQHLEKSDPFALWCEVAPRTASIVWDTWYEWEDSEWMKVRKEKNKLNAPI
SVYEVHLGSWQRDPSDPERHLTYKEIAASLVPYVKEMGFTHVELMPIMEHPYAPSWGYQI
TGYFSCSSRMGTPQELMYLIDQLHQAGIGVYMDWVPSHFPGDAHGLFRFDGTSLYEHEDP
RKGYHPDWKSYIFNYGRNEVRSFLISNAIFWLDRYHSDGLRVDAVASMLYLDYSRKHGEW
IPNEFGGRENLEAISLLREMNVAVYTEFPDIQTIAEESTAFPGVSRPVFVGGLGFGMKWM
MGWMNDTLKYFEKDPSFRKWHQDQLTFSLVYAFSENFMLPFSHDEVVYGKKSLINKMPGD
EWQRFANLRLMFTYMFTHPGTKLMFMGGEFGQTSEWNFQQSLDWHLLEHAPHKGIRECVI
ALNKLYREEPALFDYSFSHDGFEWIDTQDRENSVLVYARKSTDPARNVIVALNLTPVPRK
NYRVGVISEGSWQEIFNSDAEAFGGSGIINYDPVTAESHQWHGKAHSLILDLPPLGAVVL
KKVAPTRK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtcaatcggaaagaagaaaacaaacgcaaccatcgaacctgccgaagatgcc
ggcacgcctgtcgcggcccaatcggtgaatgcggtggaaaccattagccgttttacagac
ttcgatatacacttgttccgtcagggcaagcattttaagctatacgagaagctggggtcg
catgtgatggaggtgaatggggtagtagggacttactttgccgtatgggctcctaatgct
acgtatctgtcggtagtcgggaacttcaacggctggaaccacggcagccattcgctggca
ccgcggtgggacagttcgggtatctgggaaggctggattccgaatgtgggggtaggagag
gtttataaatactacattatatccagcaacggacagcacctcgaaaagtcggacccgttt
gcgctctggtgcgaagtggcgccgcgcacggcttccatcgtgtgggatacgtggtacgaa
tgggaagactcggaatggatgaaagtccgcaaggaaaagaataagctgaacgcgcccatt
tcggtgtacgaagtgcatttgggctcctggcagcgcgatccgtcggaccccgagcggcat
cttacctataaagaaattgccgcgagcctggtgccttatgtgaaggaaatgggctttacg
cacgtggagctgatgccgatcatggagcacccttacgcgccgtcgtggggctaccagatc
accggctacttctcgtgctcgtcgcgcatgggtacgccgcaggagctgatgtacctgatc
gaccagctgcaccaggcgggcattggtgtgtatatggactgggtcccgtcgcacttcccg
ggcgacgcgcatggccttttccgcttcgacggcacatcgctttacgagcacgaagacccg
cgcaaaggttaccatcccgactggaaaagttatattttcaactacggcagaaacgaagta
cgctcgtttttgatcagtaatgccatattctggctcgatcgctaccattccgacggcttg
cgcgtagatgcggtggcctcgatgctttacctcgactactcgcggaagcacggcgaatgg
attccgaacgaattcggcggtcgcgaaaatctcgaagcgatctcgctgctgcgcgaaatg
aatgtggctgtttacaccgaattcccggatattcagacgattgcggaagagtcaactgcc
ttcccgggcgtatcccgaccggtttttgtaggcggactgggctttggcatgaaatggatg
atgggctggatgaacgataccttgaagtatttcgaaaaagacccttcgttccgcaagtgg
catcaggaccagctgactttcagtttggtatatgcattttcggaaaacttcatgctgccg
ttctcgcatgatgaggtggtgtacggcaagaaatcgctcattaacaaaatgccgggcgac
gaatggcagagattcgcgaacctgcggctcatgtttacctacatgttcacgcacccgggc
acgaagctgatgttcatgggcggggaatttggacaaacttccgaatggaacttccagcaa
agtctcgactggcatttgctggaacacgcgccgcacaaaggcattcgtgaatgtgtaatt
gccctcaacaagctgtatcgcgaagagccggccttgttcgattactcgttctcgcacgat
ggttttgaatggatcgacacgcaggaccgggagaattcggtgctcgtgtacgcccgcaaa
tctaccgacccggcgcgcaacgtgatcgtggcgctcaacctgactcccgtgcccaggaaa
aactaccgcgtgggtgtcatttccgagggaagctggcaggaaatattcaattccgacgcc
gaggcattcgggggcagcggcatcattaactacgacccggtgacggccgaaagccaccaa
tggcacggaaaagcccattcgctgatcctcgatctgcctccgctgggcgcggtggtgctg
aaaaaggtagctccaacacgaaaataa

DBGET integrated database retrieval system