KEGG   Dyadobacter fermentans: Dfer_1980Help
Entry
Dfer_1980         CDS       T00970                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dfe  Dyadobacter fermentans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dfer_1980
Enzymes [BR:dfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dfer_1980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2420403..2421311
Genome map
AA seq 302 aa AA seqDB search
MKQKVLVIGSSNTDMVVKTEHFPKPGETVLGGTFLMNPGGKGANQAVAAARLGADVRFVA
KTGNDIFGKQAREGFRKEGIDISFMTETAELASGIALITVNAQGQNEIVVASGANMDLHP
ADIPELAFENAGLALLQLEIPRETVRWALQQCAGRNIRTVLNPAPGAPLGPGFLDGLYLI
TPNETETELITGITVDSEEALERAAQHLLGSGVQNVIITLGSRGIYLASEHFTGMIAAPV
VEAVDTTAAGDVFNGALLKALADEAPLEEACRFACTAAAISVTRMGAQSSAPFLHELHSY
NE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaaagtgctcgtgataggcagctccaacaccgatatggtggtcaagacggag
cacttcccgaaaccgggcgagacggtgctgggcgggacatttctgatgaacccgggcggc
aaaggtgccaatcaggccgttgcagcagcccggctcggtgccgatgtgcggttcgttgcc
aaaacgggcaacgatattttcggaaaacaggcccgcgaaggtttcaggaaggaagggatc
gacatcagttttatgactgagactgccgagctggcgtcagggattgcgctcatcactgtc
aatgcccaaggccagaacgagatcgtcgttgcctccggcgctaatatggacctgcacccg
gccgacattccggagcttgcattcgaaaacgccggactggcgcttttgcagctcgaaatc
ccccgcgaaacagttcgctgggccttacagcaatgcgccgggcgcaacatccgcacagtc
ctcaatcccgctccgggcgcgccgctaggtccgggtttcctcgacggcctgtacctgatc
acccccaacgaaacggaaacggagctcatcaccggcattaccgtcgacagcgaagaagcg
ctggaaagagccgcgcagcacttgcttgggagcggtgttcagaatgtgattatcacattg
ggcagccggggcatttacctggccagcgaacattttaccggcatgatcgccgcgccggtt
gtggaagcggtagataccaccgctgccggggacgttttcaatggcgcactcctgaaagcg
ctcgccgatgaagccccgctcgaagaagcatgccgctttgcctgcacggcagcggctatt
tcggtcacacgcatgggcgcgcaaagctcagcccctttcttacacgaattacactcttac
aatgaataa

DBGET integrated database retrieval system