KEGG   Dyadobacter fermentans: Dfer_2482Help
Entry
Dfer_2482         CDS       T00970                                 

Definition
formyl transferase domain-containing protein
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
dfe  Dyadobacter fermentans
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dfer_2482
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dfer_2482
Enzymes [BR:dfe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     Dfer_2482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3055797..3056366
Genome map
AA seq 189 aa AA seqDB search
MKRIAIFASGSGSNAENICEYFAHREDVDVSLIFTNNPMAGVIKRALKSQIPVVFFDRKT
FYHTGKIPQILQNEGIDLVVLAGFMMLVPPVLVEAFPNKMINIHPALLPKYGGKGMYGHF
VHEAVVNAGETESGITIHYVNEHYDEGDIIFQASCEVTPGDSPDDVARKVHTLEYAHYPR
VIDEILNRQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaattgccatttttgcatccggctcggggtccaatgccgagaacatttgtgag
tatttcgcccatcgcgaggatgtggacgtgtcgctgatattcacgaacaaccccatggcc
ggagtgatcaaaagggcgcttaaatcgcaaatccccgtcgttttcttcgacagaaaaacc
ttttaccataccggcaaaattccgcagatcctgcaaaacgaaggcatagacctggtggtg
ctcgccggatttatgatgctcgtaccacctgtgctcgtagaagcattcccgaataaaatg
atcaacattcatccggcattgcttccgaaatacggcggaaaaggcatgtacgggcatttc
gtgcacgaggcggttgtgaatgccggcgaaaccgaatcgggcatcacgatccattatgtg
aacgagcattacgacgaaggagacatcattttccaggccagctgcgaggtgacacccggc
gactcgcccgacgacgtcgcacgcaaggtacacaccctcgaatacgcgcattatccgcgc
gtgatcgacgaaatcctgaacagacagtaa

DBGET integrated database retrieval system