KEGG   Dyadobacter fermentans: Dfer_2482Help
Entry
Dfer_2482         CDS       T00970                                 

Definition
formyl transferase domain-containing protein
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
dfe  Dyadobacter fermentans
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dfe00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dfe00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3055797..3056366
Genome map
AA seq 189 aa AA seqDB search
MKRIAIFASGSGSNAENICEYFAHREDVDVSLIFTNNPMAGVIKRALKSQIPVVFFDRKT
FYHTGKIPQILQNEGIDLVVLAGFMMLVPPVLVEAFPNKMINIHPALLPKYGGKGMYGHF
VHEAVVNAGETESGITIHYVNEHYDEGDIIFQASCEVTPGDSPDDVARKVHTLEYAHYPR
VIDEILNRQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaattgccatttttgcatccggctcggggtccaatgccgagaacatttgtgag
tatttcgcccatcgcgaggatgtggacgtgtcgctgatattcacgaacaaccccatggcc
ggagtgatcaaaagggcgcttaaatcgcaaatccccgtcgttttcttcgacagaaaaacc
ttttaccataccggcaaaattccgcagatcctgcaaaacgaaggcatagacctggtggtg
ctcgccggatttatgatgctcgtaccacctgtgctcgtagaagcattcccgaataaaatg
atcaacattcatccggcattgcttccgaaatacggcggaaaaggcatgtacgggcatttc
gtgcacgaggcggttgtgaatgccggcgaaaccgaatcgggcatcacgatccattatgtg
aacgagcattacgacgaaggagacatcattttccaggccagctgcgaggtgacacccggc
gactcgcccgacgacgtcgcacgcaaggtacacaccctcgaatacgcgcattatccgcgc
gtgatcgacgaaatcctgaacagacagtaa

DBGET integrated database retrieval system