KEGG   Dyadobacter fermentans: Dfer_2482Help
Entry
Dfer_2482         CDS       T00970                                 

Definition
(GenBank) formyl transferase domain protein
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00230  Purine metabolism
dfe00670  One carbon pool by folate
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01130  Biosynthesis of antibiotics
Module
dfe_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dfer_2482
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Dfer_2482
Enzymes [BR:dfe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     Dfer_2482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: ACT93700
UniProt: C6W1H0
Position
3055797..3056366
Genome map
AA seq 189 aa AA seqDB search
MKRIAIFASGSGSNAENICEYFAHREDVDVSLIFTNNPMAGVIKRALKSQIPVVFFDRKT
FYHTGKIPQILQNEGIDLVVLAGFMMLVPPVLVEAFPNKMINIHPALLPKYGGKGMYGHF
VHEAVVNAGETESGITIHYVNEHYDEGDIIFQASCEVTPGDSPDDVARKVHTLEYAHYPR
VIDEILNRQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaattgccatttttgcatccggctcggggtccaatgccgagaacatttgtgag
tatttcgcccatcgcgaggatgtggacgtgtcgctgatattcacgaacaaccccatggcc
ggagtgatcaaaagggcgcttaaatcgcaaatccccgtcgttttcttcgacagaaaaacc
ttttaccataccggcaaaattccgcagatcctgcaaaacgaaggcatagacctggtggtg
ctcgccggatttatgatgctcgtaccacctgtgctcgtagaagcattcccgaataaaatg
atcaacattcatccggcattgcttccgaaatacggcggaaaaggcatgtacgggcatttc
gtgcacgaggcggttgtgaatgccggcgaaaccgaatcgggcatcacgatccattatgtg
aacgagcattacgacgaaggagacatcattttccaggccagctgcgaggtgacacccggc
gactcgcccgacgacgtcgcacgcaaggtacacaccctcgaatacgcgcattatccgcgc
gtgatcgacgaaatcctgaacagacagtaa

DBGET integrated database retrieval system