KEGG   Dyadobacter fermentans: Dfer_2905Help
Entry
Dfer_2905         CDS       T00970                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dfe  Dyadobacter fermentans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dfe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3570960..3571574
Genome map
AA seq 204 aa AA seqDB search
MNYPSRLIEEAVAEISRLPGIGKKTALRLALHLLKRDEEQTRSLSDALLNMRTKTTYCSR
CHNIADDTLCNICSNNKRDQATICVVVDTRDVLAIESTNQYRGLYHVLGGIISPLEGIGP
SDLEIDSLMSRIEKKEGDEAVREVILALSPTMEGDTTAFYLQKRLKALGVKISTIARGIP
IGGDLEYADEITLGRSIVSRVAYD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaactatccctcacgtcttattgaggaagccgtagccgaaatatcccgtctcccggga
ataggcaaaaaaaccgcattgcgcctggcactgcatttgctgaaaagggatgaagagcaa
acgcgctcgctgtccgatgcactgctgaacatgcgcaccaaaaccacctactgttcccgc
tgccacaacatcgccgacgatacgctttgcaacatttgcagcaataacaagcgcgaccaa
gccaccatttgcgtggtggtagacacgcgcgacgtcctggcgatcgaatccacgaaccag
taccggggcctttatcacgtgctcggaggcattatttcgcctttggagggcatcggcccg
tcggatctggaaatcgattcgctgatgtcgaggatagaaaaaaaggaaggcgacgaggcc
gttcgggaagtgatactagcgctcagccccacaatggaaggcgacaccaccgcattttac
cttcaaaaaaggctcaaagccctgggcgtaaaaataagcactatcgcgagaggtattccc
ataggcggcgacctcgaatatgcggacgagatcacacttggccgcagcattgtaagccgg
gtggcttatgattaa

DBGET integrated database retrieval system