KEGG   Dyadobacter fermentans: Dfer_3102Help
Entry
Dfer_3102         CDS       T00970                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dfe  Dyadobacter fermentans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dfer_3102
   01230 Biosynthesis of amino acids
    Dfer_3102
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dfer_3102
   00030 Pentose phosphate pathway
    Dfer_3102
   00051 Fructose and mannose metabolism
    Dfer_3102
   00052 Galactose metabolism
    Dfer_3102
  Energy metabolism
   00680 Methane metabolism
    Dfer_3102
Enzymes [BR:dfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dfer_3102
Protein phosphatases and associated proteins [BR:dfe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dfer_3102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3791004..3791978
Genome map
AA seq 324 aa AA seqDB search
MKRIGVFTSGGDAPGMNACIRAVVRGACYHGIEVFGIRRGYSGMIAGDVYKMESHSVSNI
VQRGGTILKSARSKEFMTPEGRRKAYDNLQSLGIEGLIAIGGNGTFTGAMIFGNEYGIPT
VGAPGTIDNDLYGTDYTIGFDTAVNTALDAIDRIRDTASSHDRIFFIEVMGRDSGYIAIQ
SGIAGGAELVMVPEVLTPISQVVDTLKQGWSRSKSSSIIIVAEGDEEGSAQEVADKIKVQ
VDENADIRVTTLGHTQRGGTPSAYDRILASRLGLGALEGLIAGQKNVMAGIINNELVYTP
FEDTIRLPKPINEDLLRMVKILSV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattggagtttttacctcaggaggagatgcccctggtatgaacgcctgcatc
cgggcggtagtacgcggagcatgctaccatggtattgaagtatttggaatcagaagagga
tatagcggaatgatcgccggtgacgtctacaagatggagtcgcactcggttagcaatata
gtgcaaagaggaggtaccatcctcaaatcggcacgtagcaaagaattcatgactcccgaa
ggccgcaggaaggcttatgataacttgcagtcgcttggcatcgaagggcttatcgccatt
ggcggtaacggtactttcaccggcgcgatgatcttcggcaacgaatacggcatcccaacc
gtgggcgctccgggaacgatcgataacgatttgtacggaaccgactacacgatcggcttc
gacacggctgtgaacaccgcgctggacgcgatcgaccgtatccgtgacaccgccagctca
cacgaccgtatctttttcatcgaagtaatgggccgcgactcgggctacattgccattcag
tccggtatcgcaggcggtgccgagctcgtgatggttcccgaagtactcacgccgatttcc
caggtggtggataccctcaaacaaggatggagccgttcgaaatcgtcttcaatcattatc
gtggcggaaggcgacgaagaaggaagcgctcaggaagtggccgacaagatcaaagttcag
gtggatgagaacgcggatatccgtgtaaccaccctgggccacacgcagcgcggcggtacg
ccgtccgcttacgaccgcatcctggcaagccgtctcggactgggcgccctggaaggcctc
attgccggacagaaaaacgtcatggccggtatcatcaacaatgaactggtgtacacgcct
ttcgaagacacgatccggttgccgaagccaatcaatgaagacctgctgagaatggtaaaa
atcctgagcgtttaa

DBGET integrated database retrieval system