KEGG   Dyadobacter fermentans: Dfer_3192Help
Entry
Dfer_3192         CDS       T00970                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dfe  Dyadobacter fermentans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dfe00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dfe00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3904282..3905910)
Genome map
AA seq 542 aa AA seqDB search
MKRFLFGLICCMLVHSAFAQVNVIPKPTQVLTAKGAWALKAKTKIGAPADTTWAHVANML
AAQLGKATGQVPNIVKGKGDISLVVSGDASLGEEGYRLLSTPKGVTIQARTAKGAFYGVQ
TLLQLLPVEVFSETPVAGVKWTVPYVTIKDVPRYPYRGLMLDVCRHFMPIEFVKKYIDLI
ALHKQNQFHWHLTDDQGWRIEIKKYPELKTISSKRKETMKGHYRDQKFDGKPYEGFYTQD
EIREVIKYAQDRFVNVIPEIEMPGHALAALAAYPQLGNNPDKIYEVGTKWGVYDDVFMPR
EETFKFLEDVLKEVIDLFPGKYIHIGGDECPKVQWKESRFAQDLIRKEGLKDEHGLQSYV
IKRIDKFITSKGRRMIGWDEILEGGLSPNATVMSWRGIDGGIAAAKERHDVVMTPGGFCY
LDHYQADPKTQPVAFGGFTDLAKSYSFEPTPEALSAEEARHILGVQGNVWTEYMKTPAYV
QYMVWPRATALAEVGWTSKEGRNFEDFSKRLEIHKKRLDMLGVNYFGAPTNDKFEYVWPE
KK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttccttttcggactgatttgttgcatgctcgtgcactcagcattcgcgcaa
gtcaacgtcattcccaaacccacccaggtcctgaccgccaaaggcgcatgggcgcttaaa
gccaaaacgaagatcggagcgcccgcagatacgacctgggcgcacgtcgcgaatatgctt
gccgcgcagctgggcaaagccaccggccaagtacccaacatcgttaaaggcaaaggcgac
atctcactcgtggtatccggcgacgccagcctcggcgaggaaggttaccgcttgctatcc
acgcccaaaggcgtgacgatccaggcgcggactgccaaaggtgcattctacggtgttcag
acgctgctgcaattgctgccagtggaagtgttcagcgaaacacccgtggccggcgtcaaa
tggaccgtcccgtatgtaactataaaagatgtgccccgctatccatatcgcgggctcatg
ctcgatgtttgccgccatttcatgcccatcgagtttgtaaaaaaatacatcgacctgatc
gcattgcacaagcagaaccagttccactggcacctgaccgacgaccagggctggcggatc
gagatcaagaaatacccggaactgaaaacgatcagttcaaagcgtaaggaaacgatgaaa
gggcattaccgcgatcagaaattcgacggcaagccttacgaaggtttttatacccaggac
gaaataagggaagtgatcaaatatgcgcaggatcgtttcgtgaatgtgatcccggaaatc
gaaatgccgggccatgcactggcggcgctcgcggcgtatccgcagctgggcaataatccg
gacaaaatttatgaagtaggaaccaaatggggtgtttatgacgacgtgttcatgccgcgt
gaagaaactttcaagtttctcgaagacgtgcttaaagaagtgatcgacctgttcccgggc
aaatatatccacatcggcggcgacgaatgcccgaaagtgcagtggaaagaaagccgtttt
gcgcaagacctcatccgcaaggaagggctgaaagatgagcacggcctgcaaagttacgtg
atcaagcgcatcgacaagttcattacttcgaaaggccgccggatgatcggctgggacgaa
atactcgaaggcggactgtcgcccaatgcaacggtaatgagctggcgcggtatcgacggc
ggcattgcagccgcgaaagagcgccatgacgtggttatgacgcccggcggcttctgctac
ctcgatcactaccaggccgaccccaaaacgcagccggtagcattcggcggcttcaccgac
ctggccaaatcctactccttcgaacctactcccgaagcgctgtcggccgaagaagccagg
cacatcctcggcgtgcagggcaacgtatggactgaatatatgaaaacgccggcctatgtg
caatatatggtatggccccgcgccacggcattggcagaagtaggctggacctcaaaagaa
ggccgcaacttcgaagatttcagcaaacgcctcgaaatccacaaaaaacgcctagacatg
ctgggtgtaaactacttcggcgcgccgacgaatgacaagttcgaatacgtctggccggag
aaaaagtaa

DBGET integrated database retrieval system