KEGG   Dyadobacter fermentans: Dfer_3520Help
Entry
Dfer_3520         CDS       T00970                                 

Definition
(GenBank) UDP-N-acetylmuramyl-tripeptide synthetase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00300  Lysine biosynthesis
dfe00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Dfer_3520
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dfer_3520
Enzymes [BR:dfe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Dfer_3520
Peptidoglycan biosynthesis and degradation proteins [BR:dfe01011]
 Precursor biosynthesis
  Amino acid ligase
   Dfer_3520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ACT94728
UniProt: C6VTW0
Position
complement(4299061..4300536)
Genome map
AA seq 491 aa AA seqDB search
MENNPILSSLLGEVKGAIIHGYADVTVKNIILDSRKVLPGSLFVALRGTQVDGHQFITTA
ADLGAVAILCEELPEHVREDITYIQVEDSAAAMGHIAAAFYGHPSKKVKLVGVTGTNGKT
SVATFLFQLFRALGYRSGLLSTVQNQIEDEVIPSTHTTPDAVALNALLAQMAARNCSHVF
MEVSSHSVAQHRITGLHFAGGIFTNITHDHLDFHKTFDNYIKAKKGFFDALPKSAFALVN
IDDRRGTVMVQNTKARVETYSLQTLATFKGKIISDTLAGMHMDINSQEVWFRVIGRFNAY
NLLAVYGAAVLLGEKEEAVLTELSNLKSPPGRFEQFHSADLIVGIVDYAHTPDALENVLE
TITHLRNGNEQVVTVVGCGGNRDAEKRPKMAEIACRYSNRVILTSDNPRFEDPMDILDQM
RKGVPPLDYKKTTVIEDRHEAILKAGLEAQPGDIILIAGKGHENYQDVKGVKHHFDDKEV
LMEVFAKRAGN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaatccaattttgagcagcctgctcggcgaagtgaaaggggccattattcat
ggctatgccgatgtcacggtcaagaatattatcctggattccagaaaagtactgcccgga
agcctgtttgtagcattgcgcggcacgcaggtagacggccaccagtttattaccaccgct
gccgacctcggcgcagtggcaatcctttgtgaagaactgcccgagcatgtcagagaagac
attacctatatccaggtggaggactcggctgcggccatggggcatattgccgccgcattc
tacgggcatccttccaaaaaagtgaagctggtgggcgtaacgggcacaaatggtaaaacc
tcggtggcgaccttcctgtttcagcttttcagggcgctgggctaccgttccggcctgctc
tcgacggtgcagaaccagatcgaagacgaagtgatcccttccacgcacaccacgccagat
gctgttgcattgaatgcattgctggcgcaaatggccgcgcggaattgcagtcatgtattt
atggaagtaagctcgcattccgtggcgcagcaccgcattacaggtttgcatttcgcaggg
ggcatttttaccaacatcacccacgaccacctcgattttcacaagacattcgataattat
atcaaagcaaaaaagggctttttcgacgcgttgccgaaatcggccttcgcattggtgaac
atcgacgaccgccgcggcaccgtgatggtccagaacaccaaagcgcgcgtggaaacctat
tcgctgcaaacgcttgccactttcaagggaaaaatcatttccgacacgctcgcaggcatg
catatggacattaacagccaggaagtatggttccgcgtgatcggccggttcaatgcctac
aatctcctggcagtatacggcgcggcggtgcttctgggcgaaaaggaagaggccgtcttg
accgaattatccaacctgaaaagccctcccggacgctttgaacaattccattcggcagat
ctgatcgtgggtatcgtggattacgcccacacgcccgacgccctcgaaaacgtgctcgaa
acgatcacacatttgcgcaacggcaacgagcaggtggtgacggtggtaggctgcggcggc
aaccgcgacgctgaaaagcgcccgaagatggccgaaatcgcctgccggtacagcaatcgt
gtgatattgacgtcggataatccgcgtttcgaggacccgatggacattctcgaccagatg
cgcaaaggcgtgccgccattggattacaaaaaaaccaccgtgatcgaagaccgccacgag
gccattcttaaagccggactggaagcgcagccgggcgacattatcctcatcgcgggcaag
ggacacgaaaattaccaggatgtaaaaggcgtaaaacaccatttcgacgacaaggaagtg
cttatggaagtgttcgcaaaacgggcgggcaattaa

DBGET integrated database retrieval system