KEGG   Dyadobacter fermentans: Dfer_3568Help
Entry
Dfer_3568         CDS       T00970                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dfe  Dyadobacter fermentans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dfer_3568
Enzymes [BR:dfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Dfer_3568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4360888..4361379
Genome map
AA seq 163 aa AA seqDB search
MAATGQVFLLLGSNLGDRPQVLASAREAIAAQAGTITGQSGIYETEPWGITDQPSFLNQV
LEISTSLLPEDLLRIILNIEHDLGRVRYERWGARVIDIDMLYFGTTVIDSARLTVPHPRI
QDRRFVLAPLAEIAPRFTHPLLQKTSAQLLDQCPDDSAVSKIS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaccggccaggtttttcttctgctaggctccaacctcggcgatcgcccgcag
gtgctcgcaagcgcccgcgaggccattgcagcgcaggcggggaccatcaccgggcaatcg
ggcatttatgaaaccgaaccgtggggcatcaccgaccagccgtcattcctgaaccaggtc
ctcgaaatctccacttccctcctgcctgaggacttactcagaatcattctcaacatcgaa
catgacctcggacgcgtgcgctacgagcgctggggcgcacgggtgatcgatatcgatatg
ctctatttcggcaccaccgtcatagacagcgcccggcttacggtaccgcacccgcgcatt
caggaccgccgttttgtgcttgcgccgctcgctgaaatcgcgccgcgctttactcacccg
cttttgcaaaaaacctccgcccagctcctcgaccaatgtcccgacgactctgctgtttca
aaaatatcttaa

DBGET integrated database retrieval system